9LY3: La-pth

A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 2 conformation). Determined by electron microscopy at 3.4 Å resolution. Released 4 Mar 2026.

Method: Electron microscopy
Resolution: 3.4 Å
Organisms: synthetic construct, Homo sapiens
Chains: 5
Atoms: 8,771
Mol. weight: 155.24 kDa
Released: 4 Mar 2026

Explore 9LY3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LY3 contains 38 α-helices and 69 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-31	29

Chain B: 12 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	1
β-strand	9-11	3	2
β-strand	19-22	4	2
β-strand	26-28	3	3
β-strand	29	1	4
β-strand	34	1	4
α-helix	35-36	2
β-strand	37-42	6	2
α-helix	45-48	4
β-strand	52-62	11	5
α-helix	66-68	3
β-strand	77-85	9	5
α-helix	96-98	3
α-helix	99-108	10
β-strand	113-117	5	2
β-strand	127-129	3	5
α-helix	130-131	2
α-helix	139-140	2
β-strand	141-151	11	5
β-strand	164-168	5	5
β-strand	169-171	3	3
α-helix	181-182	2
β-strand	183-186	4	6
β-strand	199-203	5	6
β-strand	207-208	2	7
β-strand	214-221	8	6
β-strand	231-241	11	8
β-strand	247-258	12	8
β-strand	267-274	8	6
α-helix	279-281	3
β-strand	288-290	3	5
α-helix	291-292	2
β-strand	300	1	5
α-helix	301-303	3
β-strand	317-327	11	8
β-strand	343-349	7	8
β-strand	350-351	2	7
α-helix	353-356	4

Chain C: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	9
β-strand	14-15	2	10
β-strand	21-28	8	9
β-strand	35-42	8	11
β-strand	48-55	8	11
β-strand	60-63	4	11
β-strand	71-76	6	9
β-strand	81-86	6	9
α-helix	91-93	3
β-strand	95-97	3	12
β-strand	98-103	6	11
β-strand	112-113	2	11
α-helix	114-116	3
β-strand	117-119	3	12
β-strand	120-121	2	10
β-strand	130-133	4	13
β-strand	146-155	10	13
β-strand	161-164	4	14
α-helix	165-167	3
β-strand	173-175	3	13
α-helix	176-178	3
β-strand	179-180	2	13
β-strand	186-194	9	13
β-strand	206-210	5	14
β-strand	215-218	4	14

Chain E: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	15
β-strand	11-14	4	16
β-strand	19-26	8	15
β-strand	34-39	6	16
β-strand	46-50	5	16
β-strand	54-55	2	16
α-helix	56	1
β-strand	64-68	5	15
β-strand	71-78	8	15
α-helix	81-83	3
β-strand	86-91	6	16
β-strand	98-99	2	16
β-strand	103-107	5	16
β-strand	117-119	3	17
α-helix	123-127	5
β-strand	130-136	7	17
β-strand	140	1	18
β-strand	147-151	5	19
β-strand	161-165	5	17
α-helix	166-168	3
β-strand	174	1	18
β-strand	175-183	9	17
α-helix	184-189	6
β-strand	192-197	6	19
β-strand	206-211	6	19

Chain R: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	34-55	22
α-helix	129-132	4
α-helix	174-176	3
α-helix	177-211	35
α-helix	213-215	3
α-helix	218-244	27
α-helix	278-310	33
α-helix	317-346	30
α-helix	359-387	29
α-helix	403-406	4
α-helix	408-417	10
α-helix	419-424	6
α-helix	427-429	3
α-helix	435-456	22
α-helix	457-461	5
α-helix	464-472	9
β-strand	521	1	2
β-strand	524	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
La-pth	A	protein	36	synthetic construct
Beta-arrestin-1	B	protein	392	Homo sapiens	P49407 (AlphaFold model)
Fab30H	C	protein	237	synthetic construct
Fab30L	E	protein	213	synthetic construct
Parathyroid hormone/parathyroid hormone-related peptide receptor,Vasopressin V2 receptor	R	protein	507	Homo sapiens	P30518 (AlphaFold model), Q03431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9LY3_1 LA-PTH (chains A)
AVAEIQLMHQRAKWIQDARRRAFLHKLIAEIHTAEI

Sequence of entity 2 (B), FASTA

>9LY3_2 Beta-arrestin-1 (chains B)
MMKGTRVFKKASCNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAF
RYGREDLDVLGLTFRKDLFCANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPP
NLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQ
PTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADI
CLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLCNNREKRGLALDGKLKHEDTNLA
SSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPP
HREVPENETPVDTNLIELDTNDDDIVFEDFAR

Sequence of entity 3 (C), FASTA

>9LY3_3 Fab30H (chains C)
MEISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYC
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHH

Sequence of entity 4 (E), FASTA

>9LY3_4 Fab30L (chains E)
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFPP
SDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE

Sequence of entity 5 (R), FASTA

>9LY3_5 Parathyroid hormone/parathyroid hormone-related peptide receptor,Vasopressin V2 receptor (chains R)
DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGK
LYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYR
RCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAV
LILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQ
APPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTV
FGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVLNFILFINIVRVLA
TKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEML
FNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHARGR
TPPSLGPQDESCTTASSSLAKDTSSGS

Primary citation

Structural basis of PTH1R-beta-arrestin core engagement reveals design principles for G-protein-biased therapeutics. Zhao, L.H., He, Q., Yuan, Q. et al. Nat Struct Mol Biol (2026) 33:868-881. DOI 10.1038/s41594-026-01806-7 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
25GN 3.2 Å, receptor-arrestin

Browse structure collections

About this viewer

MolViewer shows 9LY3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.