9LZ1: PTH1R-beta-arrestin1 complex in state 2

Cryo-EM structure of PTH1R-beta-arrestin1 complex in state 2. Determined by electron microscopy at 3.2 Å resolution. Released 11 Mar 2026.

Method: Electron microscopy
Resolution: 3.2 Å
Organisms: Mus musculus, synthetic construct, Homo sapiens
Chains: 5
Atoms: 7,059
Mol. weight: 144.43 kDa
Released: 11 Mar 2026

Explore 9LZ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LZ1 contains 26 α-helices and 53 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	6
β-strand	18-22	5	6
β-strand	26-28	3	7
β-strand	29	1	8
α-helix	30	1
β-strand	34	1	8
β-strand	39-43	5	6
β-strand	52	1	9
β-strand	53-61	9	10
β-strand	78-87	10	10
α-helix	91-93	3
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-115	4	6
β-strand	127-129	3	10
α-helix	130-132	3
α-helix	139	1
β-strand	141-148	8	10
β-strand	151	1	9
α-helix	160-162	3
β-strand	166-168	3	10
β-strand	169-171	3	7
α-helix	180-182	3
β-strand	183-189	7	11
β-strand	196-203	8	11
β-strand	207-208	2	12
β-strand	214-222	9	11
β-strand	228-242	15	13
β-strand	246-252	7	13
β-strand	256-258	3	13
β-strand	262	1	13
β-strand	267-274	8	11
β-strand	288-290	3	10
β-strand	300	1	10
α-helix	301-303	3
β-strand	317-329	13	13
β-strand	342-349	8	13
β-strand	350-351	2	12
α-helix	353-356	4

Chain H: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
β-strand	13-15	3	2
β-strand	21-28	8	1
β-strand	35-42	8	3
β-strand	48-55	8	3
β-strand	60-63	4	3
β-strand	71-76	6	1
β-strand	81-86	6	1
α-helix	91-93	3
β-strand	95-97	3	2
β-strand	98-103	6	3
β-strand	110-113	4	3
β-strand	117-121	5	2

Chain L: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	4
β-strand	11-13	3	5
β-strand	20-25	6	4
β-strand	34-39	6	5
β-strand	46-50	5	5
β-strand	54-55	2	5
α-helix	56	1
β-strand	63-68	6	4
β-strand	71-76	6	4
β-strand	86-91	6	5
α-helix	97	1
β-strand	99	1	5
β-strand	103-106	4	5

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-31	29

Chain R: 12 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	179-211	33
α-helix	213-215	3
α-helix	218-244	27
α-helix	279-310	32
α-helix	317-342	26
α-helix	343-347	5
α-helix	361-391	31
α-helix	400-417	18
α-helix	435-449	15
α-helix	451-456	6
α-helix	457-461	5
α-helix	464-480	17
β-strand	504-505	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab30 heavy chain	H	protein	160	Mus musculus
Fab30 light chain	L	protein	215	Mus musculus
Long-acting PTH	P	protein	36	synthetic construct
Parathyroid hormone/parathyroid hormone-related peptide receptor	R	protein	483	Homo sapiens	Q03431 (AlphaFold model)
Beta-arrestin-1	A	protein	393	Bos taurus	P17870 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>9LZ1_1 Fab30 heavy chain (chains H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV

Sequence of entity 2 (L), FASTA

>9LZ1_2 Fab30 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (P), FASTA

>9LZ1_3 Long-acting PTH (chains P)
AVAEIQLMHQRAKWIQDARRRAFLHKLIAEIHTAEI

Sequence of entity 4 (R), FASTA

>9LZ1_4 Parathyroid hormone/parathyroid hormone-related peptide receptor (chains R)
DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGK
LYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYR
RCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLAMIYTVGYSVSLASLTVAV
LILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQ
APPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTV
FGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVLNFILFINIVRVLA
TKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEML
FNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVT
NVG

Sequence of entity 5 (A), FASTA

>9LZ1_5 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIEKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPEHETPVDTNLIELDTNDDDIVFEDFAR

Primary citation

Core conformation of arrestin coupling to parathyroid hormone type 1 receptor. Zhai, X., Guo, J., Shen, Q. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-72448-y · PubMed

Other PDB entries of the same protein (UniProt Q03431 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EMB 0.85 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal phosphorylated PTHR…
4Z8J 0.95 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal PTHR PDZ binding motif
7UZO 1.3 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
3H3G 1.94 Å, Crystal structure of the extracellular domain of the human parathyroid hormone receptor…
3C4M 1.95 Å, Structure of human parathyroid hormone in complex with the extracellular domain of its…
8D51 2.0 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
8D52 2.02 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
7UZP 2.29 Å, parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
8BIA 2.4 Å, Crystal structure of Scribble PDZ1 with PTHR
6FJ3 2.5 Å, High resolution crystal structure of parathyroid hormone 1 receptor in complex with a…
8FLQ 2.55 Å, Human PTH1R in complex with PTH(1-34) and Gs
8JR9 2.57 Å, Small molecule agonist (PCO371) bound to human parathyroid hormone receptor type 1 (PTH1R)

Browse structure collections

About this viewer

MolViewer shows 9LZ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.