Crystal structure of MYST acetyltransferase domain in complex with inhibitor 8. Determined by X-ray diffraction at 1.83 Å resolution. Released 11 Feb 2026.
Explore 9OOB in 3D Show helices and sheets RCSB PDB PDBe
9OOB contains 13 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 511-514 | 4 | 1 |
| β-strand | 517-520 | 4 | 1 |
| α-helix | 529-532 | 4 | |
| β-strand | 537-539 | 3 | 1 |
| β-strand | 546-547 | 2 | 1 |
| α-helix | 550-559 | 10 | |
| β-strand | 568-573 | 6 | 2 |
| β-strand | 576-582 | 7 | 2 |
| α-helix | 587-598 | 12 | |
| β-strand | 613-621 | 9 | 2 |
| β-strand | 626-635 | 10 | 2 |
| β-strand | 642-644 | 3 | 3 |
| β-strand | 647-649 | 3 | 2 |
| α-helix | 651-653 | 3 | |
| α-helix | 658-672 | 15 | |
| β-strand | 677 | 1 | 4 |
| β-strand | 678-679 | 2 | 3 |
| α-helix | 680 | 1 | |
| α-helix | 683-684 | 2 | |
| α-helix | 685-702 | 18 | |
| α-helix | 712-719 | 8 | |
| β-strand | 721 | 1 | 4 |
| α-helix | 723-732 | 10 | |
| β-strand | 736-739 | 4 | 5 |
| β-strand | 742-745 | 4 | 5 |
| α-helix | 749-757 | 9 | |
| α-helix | 763-766 | 4 | |
| α-helix | 770-772 | 3 | |
| β-strand | 773 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone acetyltransferase KAT8 | A | protein | 295 | Homo sapiens | Q9H7Z6 (AlphaFold model) |
>9OOB_1 Histone acetyltransferase KAT8 (chains A) MGSSHHHHHHSSGLVPRGSTKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCL KYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVHEVDGKDHKIYCQNLCLLAKLFLDHK TLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVSCIMILPPYQRRGYGRFLIA FSYELSKLESTVGSPEKPLSDLGKLSYRSYWSSVLLENLRDFRGTLSIKDLSQMTSITQN DIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPK
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1CDK | 6-(azetidin-1-yl)-N-(2-ethoxy-6-methoxybenzene-1-sulfonyl)-4-fluoro-1-benzofura… | C21 H21 F N2 O6 S | 1 |
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (CL, GOL, NA) are not listed.
Biological Activity and Structural Biology of Current KAT6A Inhibitor Chemotypes. Suwandi, A., Jin, J., Zhao, Y. et al. J Med Chem (2026) 69:2082-2114. DOI 10.1021/acs.jmedchem.5c01426 · PubMed
Other PDB entries of the same protein (UniProt Q9H7Z6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9OOB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.