Tissue inhibitor of Metalloproteinase 1 (TIMP-1). Determined by X-ray diffraction at 2.3 Å resolution. Released 24 Sept 2025.
Explore 9SOQ in 3D Show helices and sheets RCSB PDB PDBe
9SOQ contains 20 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-7 | 3 | |
| α-helix | 8-14 | 7 | |
| β-strand | 17-23 | 7 | 1 |
| β-strand | 28-29 | 2 | 2 |
| β-strand | 35-39 | 5 | 2 |
| β-strand | 40-47 | 8 | 1 |
| α-helix | 49-52 | 4 | |
| β-strand | 60-64 | 5 | 2 |
| α-helix | 67-69 | 3 | |
| β-strand | 83-87 | 5 | 1 |
| β-strand | 88-90 | 3 | 2 |
| β-strand | 93-95 | 3 | 2 |
| β-strand | 102-104 | 3 | 1 |
| α-helix | 105-107 | 3 | |
| α-helix | 110-114 | 5 | |
| α-helix | 115-119 | 5 | |
| α-helix | 121-124 | 4 | |
| β-strand | 128-131 | 4 | 3 |
| β-strand | 144-147 | 4 | 3 |
| α-helix | 148-151 | 4 | |
| α-helix | 155-157 | 3 | |
| α-helix | 159-163 | 5 | |
| β-strand | 164-170 | 7 | 4 |
| β-strand | 173-178 | 6 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-7 | 3 | |
| α-helix | 8-14 | 7 | |
| β-strand | 17-23 | 7 | 5 |
| β-strand | 28-29 | 2 | 6 |
| β-strand | 35-39 | 5 | 6 |
| β-strand | 40-47 | 8 | 5 |
| α-helix | 49-52 | 4 | |
| β-strand | 60-64 | 5 | 6 |
| β-strand | 83-87 | 5 | 5 |
| β-strand | 88-90 | 3 | 6 |
| β-strand | 93-95 | 3 | 6 |
| β-strand | 102-104 | 3 | 5 |
| α-helix | 105-107 | 3 | |
| α-helix | 110-114 | 5 | |
| α-helix | 115-119 | 5 | |
| α-helix | 121-124 | 4 | |
| β-strand | 128-131 | 4 | 7 |
| β-strand | 144-147 | 4 | 7 |
| α-helix | 148-151 | 4 | |
| α-helix | 159-163 | 5 | |
| β-strand | 164-170 | 7 | 8 |
| β-strand | 173-178 | 6 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Metalloproteinase inhibitor 1 | A, B | protein | 184 | Homo sapiens | P01033 (AlphaFold model) |
>9SOQ_1 Metalloproteinase inhibitor 1 (chains A, B) CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRF VYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTY TVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLR SQIA
| ID | Name | Formula | Copies |
|---|---|---|---|
| FLC | Citrate anion | C6 H5 O7 | 1 |
The human TIMP-1 unbound structure provides a platform for fragment screening. Shemy, A., Van Broeckhoven, J., Hellings, N. et al. Acta Crystallogr D Struct Biol (2026) 82:330-335. DOI 10.1107/S2059798326001749 · PubMed
Other PDB entries of the same protein (UniProt P01033 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9SOQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.