9T5W: Mutant R61H alphaM/beta2 headpiece complex

Cryo-EM structure of mutant R61H alphaM/beta2 headpiece complex. Determined by electron microscopy at 2.74 Å resolution. Released 25 Mar 2026.

Method: Electron microscopy
Resolution: 2.74 Å
Organism: Homo sapiens
Chains: 2
Atoms: 9,647
Mol. weight: 140.43 kDa
Ligands: CA, NAG, MN
Released: 25 Mar 2026

Explore 9T5W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9T5W contains 43 α-helices and 96 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 65 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	9-11	3	2
β-strand	21-24	4	3
α-helix	25	1
β-strand	29-33	5	3
β-strand	40	1	4
β-strand	43	1	4
β-strand	45	1	5
β-strand	47-51	5	3
β-strand	57-59	3	3
α-helix	60	1
β-strand	73	1	5
β-strand	76-80	5	6
β-strand	85-96	12	6
β-strand	101-110	10	6
α-helix	117-118	2
β-strand	119-120	2	6
α-helix	125-127	3
β-strand	133-140	8	7
α-helix	147-164	18
β-strand	170-176	7	7
β-strand	180-184	5	7
α-helix	186-191	6
α-helix	195-199	5
β-strand	209	1	8
α-helix	211-217	7
α-helix	218-222	5
α-helix	225-227	3
α-helix	229-230	2
β-strand	234-241	8	7
β-strand	246	1	8
α-helix	256-261	6
β-strand	264-270	7	7
α-helix	278-287	10
α-helix	289	1
β-strand	296-298	3	7
α-helix	304-310	7
α-helix	313-315	3
β-strand	317	1	9
β-strand	328	1	9
β-strand	338	1	10
β-strand	342-343	2	10
β-strand	348-352	5	10
α-helix	355-358	4
β-strand	360	1	11
β-strand	361-365	5	10
β-strand	371-374	4	10
α-helix	376-378	3
β-strand	388	1	11
β-strand	391-396	6	12
β-strand	401-407	7	12
α-helix	410-412	3
β-strand	414	1	13
β-strand	415-422	8	12
β-strand	425-433	9	12
β-strand	441	1	13
β-strand	444-448	5	14
β-strand	458-467	10	14
β-strand	472	1	14
β-strand	473	1	15
β-strand	474-479	6	14
α-helix	480-481	2
β-strand	492-495	4	14
β-strand	505	1	15
β-strand	509-513	5	16
β-strand	522-527	6	16
α-helix	530-533	4
β-strand	536-540	5	16
β-strand	542-543	2	17
β-strand	547-548	2	17
β-strand	554-557	4	16
α-helix	558-561	4
β-strand	572-576	5	2
β-strand	585-590	6	2
β-strand	593-598	6	2
β-strand	599	1	1
β-strand	602-611	10	18
β-strand	630	1	19
β-strand	634-644	11	18
β-strand	657-665	9	20
β-strand	675-676	2	18
β-strand	683-690	8	20
β-strand	695-702	8	18
β-strand	704	1	19
α-helix	713	1
β-strand	714-724	11	20
α-helix	725-727	3
α-helix	733-735	3
β-strand	736-737	2	18
β-strand	745-749	5	20

Chain B: 18 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	11-17	7
β-strand	21-22	2	21
α-helix	36-39	4
β-strand	41-42	2	21
α-helix	43-47	5
β-strand	64	1	22
β-strand	76-77	2	23
β-strand	80-82	3	22
β-strand	87	1	24
β-strand	91-97	7	23
α-helix	102-104	3
β-strand	105-111	7	25
β-strand	112	1	26
α-helix	115-117	3
α-helix	121-138	18
β-strand	142-146	5	25
β-strand	149	1	26
α-helix	177-179	3
β-strand	183	1	27
β-strand	186-189	4	25
α-helix	192-201	10
β-strand	212	1	28
α-helix	214-223	10
α-helix	225-228	4
β-strand	234-241	8	25
β-strand	245	1	28
α-helix	250-254	5
α-helix	259-260	2
β-strand	266	1	29
β-strand	270	1	27
β-strand	271	1	29
α-helix	274-276	3
α-helix	278-281	4
α-helix	282-292	11
β-strand	294-300	7	25
α-helix	302-304	3
α-helix	305-314	10
β-strand	319-322	4	25
α-helix	328-340	13
β-strand	343-349	7	22
β-strand	357-363	7	23
β-strand	369-373	5	23
β-strand	376-381	6	22
β-strand	387-394	8	23
β-strand	395	1	24
β-strand	402-408	7	22
β-strand	414-419	6	22
β-strand	437	1	30
β-strand	440	1	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Integrin alpha-M	A	protein	763	Homo sapiens	P11215 (AlphaFold model)
Integrin beta-2	B	protein	469	Homo sapiens	P05107 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9T5W_1 Isoform 2 of Integrin alpha-M (chains A)
FNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYSTGSCEPI
HLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQK
FPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEF
RIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVI
TDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVN
NFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAITSNGPLLSTVGSYDWAG
GVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLVLGAPRYQHIGLVAMFR
QNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAPHYYEQTRGGQVSVCPL
PRGQRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAIGAPGEEDNRGAVYLF
HGTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVDLTVGAQGHVLLLRSQ
PVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKSTRDRLREGQIQSVVT
YDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPNCIEDPVSPIVLRLNF
SLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNTGGENLYFQ

Sequence of entity 2 (B), FASTA

>9T5W_2 Integrin beta-2 (chains B)
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPT
SLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDD
LRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPF
AFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFA
TDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAV
TSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTY
DSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVL
PQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCEPAAENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	5
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3
MN	Manganese (II) ion	Mn	1

Primary citation

Three cryo-EM structures of complement C3d-bound alpha M beta 2 reveal an unexpected layer of dynamics for alpha I-containing integrin receptors. Lorentzen, J., Fruergaard, M.U., Lukacsi, S. et al. Sci Adv (2026) 12:eaea7241-eaea7241. DOI 10.1126/sciadv.aea7241 · PubMed

Other PDB entries of the same protein (UniProt P11215 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MF7 1.25 Å, Integrin alpha M I domain
1NA5 1.5 Å, Integrin alpha M I domain
8CE6 1.58 Å, Crystal structure of human Cd11b I domain in P212121 space group
1IDO 1.7 Å, I-domain from integrin CR3, MG2+ bound
1JLM 2.0 Å, I-domain from integrin CR3, MN2+ bound
4XW2 2.0 Å, Structural basis for simvastatin competitive antagonism of complement receptor 3
8CE9 2.11 Å, Crystal structure of human Cd11b I domain in C121 space group
1M1U 2.3 Å, An isoleucine-based allosteric switch controls affinity and shape shifting in integrin…
1N9Z 2.5 Å, Integrin alpha M I domain mutant
9RM9 2.6 Å, Cryo-EM structure of alphaM/beta2 headpiece complex without alphaM I-domain - the…
1BHO 2.7 Å, Mac-1 I domain magnesium complex
1BHQ 2.7 Å, Mac-1 I domain cadmium complex

Browse structure collections

About this viewer

MolViewer shows 9T5W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.