9T65: Inactive protein-arginine deiminase type-6

Complex linking two cytoplasmic lattice filaments. Determined by electron microscopy at 5.6 Å resolution. Released 12 Aug 2026.

Method: Electron microscopy
Resolution: 5.6 Å
Organism: Mus musculus
Chains: 12
Atoms: 35,990
Mol. weight: 875.17 kDa
Released: 12 Aug 2026

Explore 9T65 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9T65 contains 293 α-helices and 528 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 57 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	1
β-strand	15-20	6	2
β-strand	25-28	4	1
β-strand	39-44	6	3
β-strand	48-51	4	1
β-strand	56-58	3	1
β-strand	63-67	5	3
β-strand	74-79	6	1
β-strand	89-92	4	2
β-strand	93-97	5	3
β-strand	100-105	6	3
β-strand	108-114	7	2
β-strand	115-119	5	4
α-helix	134-138	5
β-strand	141	1	5
β-strand	147	1	5
β-strand	150-151	2	6
β-strand	153	1	7
α-helix	165-168	4
α-helix	175-177	3
β-strand	179	1	7
β-strand	182-186	5	4
α-helix	189-194	6
β-strand	195-201	7	6
α-helix	203-208	6
β-strand	209-213	5	7
β-strand	222-223	2	7
β-strand	226	1	8
β-strand	229	1	8
β-strand	231-233	3	6
α-helix	234-236	3
β-strand	242-244	3	4
β-strand	245-249	5	7
β-strand	254	1	9
β-strand	257	1	9
β-strand	260-269	10	6
β-strand	279-280	2	6
β-strand	284-290	7	6
α-helix	291-293	3
β-strand	294	1	10
β-strand	305-308	4	11
α-helix	315-327	13
β-strand	331-332	2	11
α-helix	341	1
α-helix	344-348	5
β-strand	349-355	7	10
β-strand	360-366	7	10
α-helix	377-381	5
α-helix	383	1
β-strand	386-390	5	10
α-helix	404-406	3
β-strand	407-409	3	12
β-strand	413-415	3	13
β-strand	418-420	3	13
β-strand	425-429	5	12
α-helix	442-449	8
β-strand	458-460	3	12
β-strand	464	1	14
α-helix	469-471	3
β-strand	473-477	5	15
β-strand	488-494	7	15
α-helix	495-505	11
α-helix	506-510	5
β-strand	514	1	16
α-helix	521-527	7
β-strand	533	1	16
α-helix	534-539	6
α-helix	541-565	25
α-helix	569-571	3
β-strand	572-576	5	15
β-strand	580-583	4	14
α-helix	589-591	3
β-strand	596-599	4	14
α-helix	603-604	2
β-strand	609-611	3	17
β-strand	614-618	5	17
β-strand	624	1	18
β-strand	629	1	18
α-helix	630-642	13
β-strand	645-649	5	17
α-helix	652-656	5
α-helix	657-658	2
β-strand	665-668	4	11
α-helix	671-673	3
α-helix	677-679	3

Chain B: 25 helices, 51 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	19
β-strand	6-8	3	20
α-helix	14	1
β-strand	15-20	6	19
β-strand	24-28	5	20
β-strand	39-44	6	19
β-strand	48-52	5	20
β-strand	55-58	4	20
β-strand	65-68	4	19
β-strand	74-79	6	20
β-strand	89-97	9	19
β-strand	100-114	15	19
β-strand	115-119	5	21
α-helix	134-138	5
β-strand	150-151	2	22
β-strand	153	1	21
α-helix	165-168	4
α-helix	175-177	3
β-strand	179-186	8	21
α-helix	189-194	6
β-strand	195-200	6	22
α-helix	203-208	6
β-strand	209-213	5	21
β-strand	222-225	4	21
β-strand	226	1	23
β-strand	229	1	23
β-strand	231-233	3	22
α-helix	234-236	3
β-strand	242-249	8	21
β-strand	254	1	24
β-strand	257	1	24
β-strand	260-269	10	22
β-strand	279-290	12	22
β-strand	294	1	25
α-helix	301	1
β-strand	302-308	7	26
α-helix	315-326	12
β-strand	331-334	4	26
α-helix	344-348	5
β-strand	349-356	8	25
β-strand	359-366	8	25
α-helix	377-381	5
α-helix	383	1
β-strand	387-390	4	25
β-strand	408-409	2	27
β-strand	413-415	3	28
β-strand	418-420	3	28
β-strand	425-429	5	27
α-helix	442-449	8
β-strand	457-460	4	27
β-strand	464	1	29
α-helix	469-471	3
β-strand	473-477	5	30
β-strand	488-493	6	30
α-helix	495-505	11
α-helix	506-510	5
β-strand	514	1	31
α-helix	521-527	7
β-strand	533	1	31
α-helix	534-539	6
α-helix	541-565	25
β-strand	572-575	4	30
β-strand	580-582	3	29
β-strand	597-599	3	29
α-helix	603-604	2
β-strand	609-611	3	32
β-strand	614-618	5	32
β-strand	624-625	2	33
β-strand	628-629	2	33
α-helix	630-642	13
β-strand	645-649	5	32
α-helix	652-656	5
α-helix	657-658	2
β-strand	666-670	5	26
α-helix	671-673	3
α-helix	677-679	3

Chain C: 28 helices, 51 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	34
β-strand	6-8	3	35
α-helix	14	1
β-strand	15-20	6	34
β-strand	25-28	4	35
β-strand	39-44	6	34
β-strand	49-51	3	35
β-strand	56-58	3	35
β-strand	65-68	4	34
β-strand	74-77	4	35
β-strand	89-97	9	34
β-strand	100-114	15	34
β-strand	115-119	5	36
α-helix	134-138	5
β-strand	141	1	37
β-strand	147	1	37
β-strand	150-151	2	38
β-strand	153	1	36
α-helix	166-169	4
α-helix	175-177	3
β-strand	179-186	8	36
α-helix	189-193	5
β-strand	195-200	6	38
α-helix	203-208	6
β-strand	209-213	5	36
β-strand	222-225	4	36
β-strand	226	1	39
β-strand	229	1	39
β-strand	231-233	3	38
α-helix	234-237	4
β-strand	242-249	8	36
β-strand	254	1	40
β-strand	257	1	40
β-strand	260-269	10	38
α-helix	277-278	2
β-strand	279-290	12	38
α-helix	291-293	3
β-strand	294	1	41
β-strand	306-308	3	42
α-helix	314-326	13
β-strand	332-334	3	42
α-helix	344-348	5
β-strand	349-355	7	41
β-strand	360-366	7	41
α-helix	378-381	4
α-helix	383	1
β-strand	387-390	4	41
β-strand	408-409	2	43
α-helix	410-412	3
β-strand	413-415	3	44
β-strand	418-420	3	44
β-strand	425-429	5	43
α-helix	442-449	8
β-strand	457-460	4	43
β-strand	464	1	45
α-helix	469-471	3
β-strand	473-477	5	46
β-strand	488-493	6	46
α-helix	495-505	11
α-helix	506-510	5
α-helix	521-526	6
α-helix	534-539	6
α-helix	541-565	25
α-helix	569-571	3
β-strand	572-575	4	46
β-strand	579-582	4	45
α-helix	589-591	3
β-strand	597-600	4	45
β-strand	609-611	3	47
β-strand	614-618	5	47
β-strand	624	1	48
β-strand	629	1	48
α-helix	630-642	13
β-strand	645-649	5	47
α-helix	652-656	5
α-helix	657-658	2
β-strand	665-667	3	42
α-helix	671-673	3
α-helix	677-679	3

Chain D: 24 helices, 59 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	49
β-strand	6-8	3	50
β-strand	15-20	6	49
β-strand	25-28	4	50
β-strand	39-43	5	49
β-strand	48-51	4	50
β-strand	56-57	2	50
β-strand	64-68	5	49
β-strand	74-79	6	50
β-strand	89-96	8	49
β-strand	106-114	9	49
β-strand	115	1	51
β-strand	118-119	2	52
α-helix	134-138	5
β-strand	149-151	3	53
β-strand	153	1	52
α-helix	165-169	5
α-helix	173-177	5
β-strand	179-184	6	52
β-strand	186	1	51
α-helix	189-192	4
β-strand	195-200	6	53
α-helix	203-208	6
β-strand	209-213	5	52
β-strand	222-223	2	52
β-strand	226	1	54
β-strand	229	1	54
β-strand	231-234	4	53
α-helix	235-237	3
β-strand	242-249	8	52
β-strand	254	1	55
β-strand	257	1	55
β-strand	260-269	10	53
β-strand	273	1	56
β-strand	276	1	56
β-strand	279-280	2	53
β-strand	284-290	7	53
β-strand	294	1	57
α-helix	301	1
β-strand	302	1	58
β-strand	306-308	3	59
α-helix	314-327	14
β-strand	333-334	2	59
α-helix	344-348	5
β-strand	349-355	7	57
β-strand	360-366	7	57
α-helix	377-381	5
α-helix	383	1
β-strand	387	1	57
β-strand	408-409	2	60
α-helix	410-412	3
β-strand	413-415	3	61
β-strand	418-420	3	61
β-strand	425-426	2	60
β-strand	427-429	3	62
α-helix	442-451	10
β-strand	458-460	3	62
β-strand	464	1	63
α-helix	469-471	3
β-strand	473-477	5	64
β-strand	488-493	6	64
α-helix	495-507	13
α-helix	510-512	3
β-strand	514	1	65
α-helix	521-526	6
β-strand	533	1	65
α-helix	534-539	6
α-helix	541-565	25
α-helix	569-571	3
β-strand	572-575	4	64
β-strand	580-582	3	63
β-strand	597-599	3	63
α-helix	603-604	2
β-strand	609-611	3	66
β-strand	614-618	5	66
β-strand	624	1	67
β-strand	629	1	67
α-helix	630-642	13
β-strand	647-649	3	66
α-helix	652-656	5
β-strand	665-667	3	59
β-strand	670	1	58
α-helix	677-679	3

Chain E: 23 helices, 53 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	68
β-strand	6-8	3	69
β-strand	15-20	6	68
β-strand	25-28	4	69
β-strand	39-44	6	68
β-strand	48-52	5	69
β-strand	55-58	4	69
β-strand	64-68	5	68
β-strand	74-79	6	69
β-strand	89-96	8	68
β-strand	105-114	10	68
β-strand	115-119	5	70
β-strand	123	1	71
α-helix	134-138	5
β-strand	148	1	71
β-strand	150-151	2	72
β-strand	153	1	70
α-helix	166-169	4
α-helix	175-177	3
β-strand	179-186	8	70
α-helix	189-193	5
β-strand	195-200	6	72
α-helix	203-208	6
β-strand	209-213	5	70
β-strand	222-225	4	70
β-strand	226	1	73
β-strand	229	1	73
β-strand	231-234	4	72
α-helix	235-237	3
β-strand	242-249	8	70
β-strand	260-269	10	72
β-strand	273	1	74
β-strand	276	1	74
β-strand	282-290	9	72
β-strand	294	1	75
α-helix	301	1
β-strand	302	1	76
β-strand	306-308	3	77
α-helix	314-326	13
β-strand	332-334	3	77
α-helix	344-348	5
β-strand	349-355	7	75
β-strand	360-366	7	75
α-helix	378-381	4
α-helix	383	1
β-strand	387-390	4	75
β-strand	407-409	3	78
β-strand	413-415	3	79
β-strand	418-420	3	79
β-strand	425-429	5	78
α-helix	442-451	10
β-strand	458-460	3	78
β-strand	464	1	80
α-helix	469-472	4
β-strand	473-477	5	81
β-strand	488-493	6	81
α-helix	495-507	13
α-helix	510-512	3
β-strand	514	1	82
α-helix	521-527	7
β-strand	533	1	82
α-helix	534-539	6
α-helix	541-565	25
β-strand	572-575	4	81
β-strand	579-582	4	80
β-strand	597-600	4	80
α-helix	603-604	2
β-strand	609-611	3	83
β-strand	614-618	5	83
α-helix	630-642	13
β-strand	645-649	5	83
α-helix	652-656	5
α-helix	657-658	2
β-strand	666-667	2	77
β-strand	670	1	76
α-helix	677-679	3

Chain F: 26 helices, 54 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	84
β-strand	15-20	6	85
β-strand	25-28	4	84
β-strand	39-44	6	85
β-strand	48-52	5	84
β-strand	55-58	4	84
β-strand	65-68	4	85
β-strand	74-79	6	84
β-strand	89-96	8	85
β-strand	97	1	86
β-strand	100	1	86
β-strand	106-114	9	85
β-strand	115-119	5	87
α-helix	134-138	5
β-strand	149-151	3	88
β-strand	153	1	87
α-helix	157-159	3
α-helix	165-169	5
α-helix	175-177	3
β-strand	179-186	8	87
α-helix	189-193	5
β-strand	195-200	6	88
α-helix	203-208	6
β-strand	209-213	5	87
β-strand	222-223	2	87
β-strand	226	1	89
β-strand	229	1	89
β-strand	231-234	4	88
α-helix	235-237	3
β-strand	242-249	8	87
β-strand	260-269	10	88
β-strand	273	1	90
β-strand	276	1	90
β-strand	279-290	12	88
α-helix	291-293	3
β-strand	294	1	91
β-strand	302-308	7	92
α-helix	314-326	13
β-strand	332-334	3	92
α-helix	344-348	5
β-strand	349-355	7	91
β-strand	360-366	7	91
α-helix	377-381	5
α-helix	383	1
β-strand	387-390	4	91
β-strand	408-409	2	93
β-strand	413-415	3	94
β-strand	418-420	3	94
β-strand	425-429	5	93
α-helix	442-451	10
β-strand	457-460	4	93
β-strand	464	1	95
α-helix	469-471	3
β-strand	473-477	5	96
β-strand	488-494	7	96
α-helix	495-505	11
α-helix	506-510	5
β-strand	514	1	97
α-helix	521-526	6
β-strand	533	1	97
α-helix	534-539	6
α-helix	541-565	25
α-helix	569-571	3
β-strand	572-576	5	96
β-strand	579-582	4	95
β-strand	597-600	4	95
β-strand	609-611	3	98
β-strand	614-616	3	98
β-strand	617-618	2	99
β-strand	624	1	100
β-strand	629	1	100
α-helix	630-639	10
α-helix	640-642	3
β-strand	645	1	98
β-strand	648-649	2	99
α-helix	652-656	5
α-helix	657-658	2
β-strand	665-670	6	92
α-helix	671-673	3
α-helix	677-679	3

Chain G: 27 helices, 58 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	101
β-strand	8	1	102
β-strand	15-16	2	103
β-strand	18	1	101
β-strand	19-20	2	104
β-strand	25-28	4	102
β-strand	39-44	6	103
β-strand	48-52	5	102
β-strand	55-58	4	102
β-strand	65-68	4	103
β-strand	74-79	6	102
β-strand	89-96	8	103
β-strand	103-111	9	103
β-strand	113-114	2	104
β-strand	115-119	5	105
α-helix	134-138	5
β-strand	149-151	3	106
β-strand	153	1	105
α-helix	157-159	3
α-helix	165-169	5
α-helix	171-172	2
α-helix	175-177	3
β-strand	179-186	8	105
α-helix	189-193	5
β-strand	195-200	6	106
α-helix	203-208	6
β-strand	209-213	5	105
β-strand	222-223	2	105
β-strand	226	1	107
β-strand	229	1	107
β-strand	231-234	4	106
β-strand	242-249	8	105
β-strand	254	1	108
β-strand	257	1	108
β-strand	260-269	10	106
β-strand	273	1	109
β-strand	276	1	109
β-strand	279-290	12	106
α-helix	291-293	3
β-strand	294	1	110
α-helix	301	1
β-strand	302	1	111
β-strand	305-308	4	112
α-helix	315-327	13
β-strand	331-334	4	112
α-helix	341	1
α-helix	344-348	5
β-strand	350-355	6	110
β-strand	360-366	7	110
α-helix	378-381	4
α-helix	383	1
β-strand	386-390	5	110
α-helix	404-406	3
β-strand	407-409	3	113
β-strand	413-415	3	114
β-strand	418-420	3	114
β-strand	425-429	5	113
α-helix	442-451	10
β-strand	458-460	3	113
β-strand	464	1	115
α-helix	469-471	3
β-strand	473-477	5	116
β-strand	488-493	6	116
α-helix	495-505	11
α-helix	506-510	5
β-strand	514	1	117
α-helix	521-526	6
β-strand	533	1	117
α-helix	534-539	6
α-helix	541-565	25
β-strand	572-575	4	116
β-strand	579-582	4	115
β-strand	597-600	4	115
β-strand	609-611	3	118
β-strand	614-618	5	118
β-strand	624	1	119
β-strand	629	1	119
α-helix	630-642	13
β-strand	645-649	5	118
α-helix	652-656	5
α-helix	657-658	2
β-strand	665-667	3	112
β-strand	670	1	111
α-helix	671-673	3
α-helix	677-679	3

Chain H: 25 helices, 53 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	120
β-strand	15-20	6	121
β-strand	25-28	4	120
β-strand	39-44	6	121
β-strand	48-52	5	120
β-strand	55-58	4	120
β-strand	64-67	4	121
β-strand	74-79	6	120
β-strand	89-97	9	121
β-strand	100-114	15	121
β-strand	115-119	5	122
α-helix	134-138	5
β-strand	149-151	3	123
β-strand	153	1	124
α-helix	166-169	4
α-helix	171-172	2
β-strand	182-186	5	122
α-helix	189-193	5
β-strand	195-200	6	123
α-helix	203-208	6
β-strand	209-213	5	124
β-strand	222-225	4	124
β-strand	226	1	125
β-strand	229	1	125
β-strand	231-233	3	123
β-strand	242-244	3	122
β-strand	245-249	5	124
β-strand	254	1	126
β-strand	257	1	126
β-strand	260-269	10	123
β-strand	279-290	12	123
α-helix	291-293	3
β-strand	294	1	127
α-helix	301	1
β-strand	302	1	128
β-strand	306-308	3	129
α-helix	314-326	13
β-strand	332-333	2	129
α-helix	344-348	5
β-strand	349-356	8	127
β-strand	359-366	8	127
α-helix	377-381	5
α-helix	383	1
β-strand	386-390	5	127
α-helix	404-406	3
β-strand	407-409	3	130
β-strand	413-415	3	131
β-strand	418-420	3	131
β-strand	425-429	5	130
α-helix	442-451	10
β-strand	458-460	3	130
β-strand	464	1	132
α-helix	469-471	3
β-strand	473-477	5	133
β-strand	488-493	6	133
α-helix	495-507	13
α-helix	510-512	3
β-strand	514	1	134
α-helix	521-527	7
β-strand	533	1	134
α-helix	534-539	6
α-helix	541-565	25
α-helix	569-571	3
β-strand	572-575	4	133
β-strand	579-582	4	132
α-helix	589-591	3
β-strand	597-600	4	132
β-strand	609-611	3	135
β-strand	614-616	3	135
β-strand	617-618	2	136
α-helix	630-642	13
β-strand	645	1	135
β-strand	648-649	2	136
α-helix	652-656	5
β-strand	665-667	3	129
β-strand	670	1	128
α-helix	671-673	3
α-helix	677-679	3

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Inactive protein-arginine deiminase type-6	A, B, C, D, E, F, G, H	protein	682	Mus musculus	Q8K3V4 (AlphaFold model)
S-phase kinase-associated protein 1	l	protein	163	Mus musculus	Q9WTX5 (AlphaFold model)
NACHT, LRR and PYD domains-containing protein 14	n	protein	993	Mus musculus	Q6B966 (AlphaFold model)
E3 ubiquitin-protein ligase UHRF1	o	protein	782	Mus musculus	Q8VDF2 (AlphaFold model)
F-box/WD repeat-containing protein	k	protein	466	Mus musculus

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>9T65_1 Inactive protein-arginine deiminase type-6 (chains A, B, C, D, E, F, G, H)
MSFQNSLSLSLVNPTHALCMVGMEITLDISKCAPDKCKSFTIRGSPRILIHISSSVIAGK
EDTVVWRSMNHPTVALVRMVAPSPTVDEDKVLVSYFCPDQEVPTATAVLFLTGIEISLEA
DIYRDGQLDMPSDKQAKKKWMWGMNGWGAILLVNCSPNAVGQPDEQSFQEGPREIQNLSQ
MNVTVEGPTSILQNYQLILHTSEEEAKKTRVYWSQRGSSAYELVVGPNKPVYLLPTFENR
RKEAFYVEATEFPSPSFSGLISLSLSLVEKAHDECIPEIPLYKDTVMFRVAPYIFMPSTQ
MPLEVYLCRELQLQGFVDSVTKLSEKSKVQVVKVYEDPNRQSKWLQDEMAFCYTQAPHKT
VSLILDTPRVSKLEDFPMKYTLTPGSGYLIRQTEDHRVASLDSIGNLMVSPPVKAQGKDY
PLGRVLIGGSFYPSSEGRDMNKGLREFVYAQQVQAPVELFSDWLMTGHMDQFMCFVPTND
KNNDQKDFRLLLASPSACFELFEQKQKEGYGNVTLFEDIGAEQLLSNGRESKTISQILAD
KSFREQNTYVEKCISLNRTLLKTELGLEDKDIILIPQLFCLEQLTNVPSNQQSTKLFARP
YFPDMLQIIVLGKNLGIPKPFGPKINGTCCLEEKVCGLLEPLGLKCTFIDDFDCYLANIG
DVCASAIINRVPFAFKWWKMTP

Sequence of entity 2 (l), FASTA

>9T65_2 S-phase kinase-associated protein 1 (chains l)
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

Sequence of entity 3 (n), FASTA

>9T65_3 NACHT, LRR and PYD domains-containing protein 14 (chains n)
MKTEDDEMEYEASKEETVSEDKDFDDGIDYRTVIKENIFTMWYKTSLHGEFATLNCVITP
KDQNLLQHIFDEDIQTSEAPQTVVLQGAAGIGKTTLLKKAVLEWADGNLYQQFTHVFYLN
GKEISQVKEKSFAQLISKHWPSSEGPIEQVLSKPSSLLFIIDSFDELDFSFEEPQFALCK
DWTQISPVSFLISSLLRKVMLPESYLLVATRSTAWKRLVPLLQKPQRVKLSGLSKNARMD
YIHHLLKDKAWATSAIYSLRMNWRLFHMCHVCHMCQMICAVLKGQVEKGGRVEETCKTST
ALFTYYICSLFPRIPVGCVTLPNETLLRSLCKAAVEGIWTMKHVLYQQNLRKHELTREDI
LLFLDAKVLQQDTEYENCYMFTHLHVQEFFAALFYLLRENLEEQDYPSEPFENLYLLLES
NHIHDPHLEQMKCFLFGLLNKDRVRQLEETFNLTISMEVREELLACLEGLEKDDSSLSQL
RFQDLLHCIYETQDQEFITQALMYFQKIIVRVDEEPQLRIYSFCLKHCHTLKTMRLTARA
DLKNMLDTAEMCLEGAAVQVIHYWQDLFSVLHTNESLIEMDLYESRLDESLMKILNEELS
HPKCKLQKLIFRAVDFLNGCQDFTFLASNKKVTHLDLKETDLGVNGLKTLCEALKCKGCK
LRVLRLASCDLNVARCQKLSNALQTNRSLVFLNLSLNNLSNDGVKSLCEVLENPNSSLER
LALASCGLTKAGCKVLSSALTKSKRLTHLCLSDNVLEDEGIKLLSHTLKHPQCTLQSLVL
RSCSFTPIGSEHLSTALLHNRSLVHLDLGQNKLADNGVKLLCHSLQQPHCNLQELELMSC
VLTSKACGDLASVLVNNSNLWSLDLGHNILDDAGLNILCDALRNPNCHVQRLGLENCGLT
PGCCQDLLGILSNNKSVIQMNLMKNALDHESIKNLCKVLRSPTCKMEFLALDKKEILKKK
IKKFLVDVRINNPHLVIGPECPNTESGCWWNYF

Sequence of entity 4 (o), FASTA

>9T65_4 E3 ubiquitin-protein ligase UHRF1 (chains o)
MWIQVRTMDGKETHTVNSLSRLTKVQELRKKIEEVFHVEPQLQRLFYRGKQMEDGHTLFD
YDVRLNDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGAAEADDK
TVWEDTDLGLYKVNEYVDVRDNIFGAWFEAQVVQVQKRALSEDEPCSSSAVKTSEDDIMY
HVKYDDYPEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGFWYDVEIC
RKRQTRTARELYGNIRLLNDSQLNNCRIMFVDEVLMIELPKERRPLIASPSQPPPALRNT
GKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQLLCDECDMAFHLYCLKPPLTSVPPE
PEWYCPSCRTDSSEVVQAGEKLKESKKKAKMASATSSSRRDWGKGMACVGRTTECTIVPA
NHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNY
FTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVV
RNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKD
RTRQLGLTMQYPEGYLEALANKEKSRKRPAKALEQGPSSSKTGKSKQKSTGPTLSSPRAS
KKSKLEPYTLSEQQANLIKEDKGNAKLWDDVLTSLQDGPYQIFLSKVKEAFQCICCQELV
FRPVTTVCQHNVCKDCLDRSFRAQVFSCPACRFELDHSSPTRVNQPLQTILNQLFPGYGS
GR

Sequence of entity 5 (k), FASTA

>9T65_5 F-box/WD repeat-containing protein (chains k)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Primary citation

In-situ cryo-ET of mouse embryos reveals cytoplasmic lattices contain ubiquitin-charged E2-E3 ligase assemblies. Singh, K., Harasimov, K., Niakan, K.K. et al. EMBO J (2026). DOI 10.1038/s44318-026-00895-w · PubMed

Other PDB entries of the same protein (UniProt Q8K3V4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

24MC 3.4 Å, Structure of oocyte cytoplasmic lattices
12DL 3.5 Å, Native structure of the cytoplasmic lattice (CPL) asymmetric unit from mouse MII eggs
9XRL 3.74 Å, Structure of mouse cytoplasmic lattice (CPL) repeating unit
9SFP 4.2 Å, Native cytoplasmic lattices from mouse oocytes
9W2M 4.2 Å, Cryo-EM structure of the Cytoplasmic lattice(CPL) from mouse oocyte
9T63 4.7 Å, Asymmetric unit of a cytoplasmic lattice filament repeat unit
9T66 5.3 Å, Complex linking two repeat units of a cytoplasmic lattice filament
9T64 7.3 Å, Cytoplasmic lattice filament repeat unit with the central FBXW-SKP1 complex
9T67 7.7 Å, Cytoplasmic lattice filament repeat unit with ubiquitin
9T68 8.0 Å, Composite structure of the repeat unit of cytoplasmic lattice filament

Browse structure collections

About this viewer

MolViewer shows 9T65 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.