9U5P: HRV14 3C

HRV14 3C in complex with single chain antibody YDF and cloverleafRNA-dimer conformation. Determined by electron microscopy at 2.96 Å resolution. Released 25 Mar 2026.

Method: Electron microscopy
Resolution: 2.96 Å
Organisms: rhinovirus B14, Homo sapiens
Chains: 7
Atoms: 7,887
Mol. weight: 116.47 kDa
Released: 25 Mar 2026

Explore 9U5P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9U5P contains 16 α-helices and 83 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	4-13	10
β-strand	15-20	6	1
β-strand	23-31	9	1
β-strand	32	1	2
β-strand	34-37	4	1
α-helix	39-41	3
β-strand	46-49	4	1
β-strand	52-63	12	1
β-strand	69-78	10	1
β-strand	83	1	2
α-helix	84-85	2
α-helix	87-89	3
β-strand	90	1	3
β-strand	98-105	8	3
β-strand	108-117	10	3
β-strand	119-126	8	3
β-strand	129-137	9	3
α-helix	143-145	3
β-strand	149-152	4	3
β-strand	155-163	9	3
β-strand	168-172	5	3
α-helix	175-177	3

Chain B: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	4
β-strand	12-14	3	5
β-strand	19-27	9	4
α-helix	31-33	3
β-strand	36-41	6	5
β-strand	47-53	7	5
β-strand	60-62	3	5
β-strand	70-75	6	4
β-strand	80-86	7	4
β-strand	94-101	8	5
β-strand	105-107	3	3
β-strand	115-118	4	5
β-strand	122-126	5	5

Chain C: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	6
β-strand	9-11	3	7
β-strand	17-23	7	6
α-helix	27-29	3
β-strand	31-37	7	7
β-strand	44-47	4	7
β-strand	48	1	8
β-strand	52	1	8
β-strand	61-66	6	6
β-strand	69-75	7	6
α-helix	79-81	3
β-strand	84-91	8	7
β-strand	94-97	4	7
β-strand	102-104	3	7

Chain O: 4 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	4-13	10
β-strand	15-20	6	9
β-strand	23-31	9	9
β-strand	32	1	10
β-strand	34-37	4	9
α-helix	39-41	3
β-strand	46-49	4	9
β-strand	52-63	12	9
β-strand	69-77	9	9
β-strand	83	1	10
α-helix	87-89	3
β-strand	90	1	11
β-strand	99-105	7	11
β-strand	108-116	9	11
β-strand	119-120	2	11
β-strand	124-125	2	12
β-strand	130-131	2	12
β-strand	134-137	4	11
α-helix	148	1
β-strand	149-152	4	11
β-strand	155-163	9	11
β-strand	168-172	5	11

Chain P: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	13
β-strand	13-14	2	14
β-strand	20-27	8	13
α-helix	31-33	3
β-strand	36-41	6	15
β-strand	47-53	7	15
β-strand	60-62	3	15
β-strand	70-75	6	13
β-strand	80-85	6	13
α-helix	90-92	3
β-strand	94-99	6	15
β-strand	105-107	3	11
β-strand	118	1	15
β-strand	122-124	3	15
β-strand	125-126	2	14

Chain Q: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	16
β-strand	9-12	4	17
β-strand	18-24	7	16
α-helix	27-29	3
β-strand	31-37	7	17
β-strand	44-47	4	17
β-strand	48	1	18
β-strand	52	1	18
β-strand	61-66	6	16
β-strand	69-74	6	16
β-strand	84-91	8	17
β-strand	94-97	4	17
β-strand	102-105	4	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protease 3C	A, O	protein	180	rhinovirus B14	P03303 (AlphaFold model)
YDF heavy chain	B, P	protein	127	Homo sapiens
YDF light chain	C, Q	protein	107	Homo sapiens
RNA (83-mer)	R	RNA	83	rhinovirus B14

Sequence of entity 1 (A, O), FASTA

>9U5P_1 Protease 3C (chains A, O)
PNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYK
LVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDATLVVHSNNFTNTILEVGPVTMA
GLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLKKQYFVEK

Sequence of entity 2 (B, P), FASTA

>9U5P_2 YDF heavy chain (chains B, P)
QVQLLQSGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVGKGGYDFWSGSGYMDVWGKGT
TVTVSSG

Sequence of entity 3 (C, Q), FASTA

>9U5P_3 YDF light chain (chains C, Q)
SYVLTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDSKRPSGIPER
FSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVLG

Sequence of entity 4 (R), FASTA

>9U5P_4 RNA (83-MER) (chains R)
GGGAAACAGCGGAUGGGUAUCCCACCAUUCGACCCAUUGGGUGUAGUACUCUGGUACUAU
GUACCUUUGUACGCCUGUUUCCC

Primary citation

HRV14 3C in complex with single chain antibody YDF and cloverleafRNA,dimer conformation. Yang, B., Wang, Q., Sun, S.W. et al. To be published.

Other PDB entries of the same protein (UniProt P03303 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KYZ 1.84 Å, HRV14 3C in complex with single chain antibody YDF
9LGP 2.11 Å, Crystal structure of the HRV B14 3C protease in complex with AG7404
5W3M 2.26 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
6KZ0 2.4 Å, HRV14 3C in complex with single chain antibody GGVV
7BG7 2.4 Å, HRV14 in complex with its receptor ICAM-1
1NCQ 2.5 Å, The structure of HRV14 when complexed with pleconaril, an antiviral compound
5W3E 2.53 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
7BG6 2.6 Å, HRV14 native particle solved by cryoEM
31LE 2.64 Å, HRV E1007A mutant
1K5M 2.7 Å, Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3…
31LF 2.71 Å, HRV virion E2250A mutant
5W3L 2.71 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar…

Browse structure collections

About this viewer

MolViewer shows 9U5P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.