1B7T: Myosin digested by papain

Name: PDB 1B7T: Myosin digested by papain
Published: 1999-05-12
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: myosin

Myosin digested by papain. Determined by X-ray diffraction at 2.5 Å resolution. Released 12 May 1999.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Argopecten irradians
Chains: 3
Atoms: 8,383
Mol. weight: 131.03 kDa
Ligands: MG, ADP, CA
Released: 12 May 1999

Explore 1B7T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B7T contains 55 α-helices and 32 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 39 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
β-strand	33-37	5	1
β-strand	43-50	8	1
β-strand	55-60	6	1
β-strand	66-70	5	1
α-helix	71-73	3
β-strand	75-76	2	1
α-helix	77-79	3
α-helix	80-82	3
β-strand	87	1	2
α-helix	88-90	3
α-helix	96-107	12
β-strand	113-116	4	2
β-strand	119-123	5	2
α-helix	134-140	7
α-helix	152-162	11
α-helix	163-167	5
β-strand	169-175	7	2
α-helix	182-196	15
α-helix	215-220	6
α-helix	222-230	9
β-strand	231-232	2	3
β-strand	240-241	2	3
β-strand	244-251	8	2
β-strand	257-265	9	2
α-helix	269-272	4
β-strand	282	1	3
α-helix	283-287	5
α-helix	294-296	3
α-helix	297-300	4
α-helix	306-308	3
α-helix	310-312	3
α-helix	324-337	14
α-helix	344-358	15
β-strand	363	1	4
β-strand	374	1	4
α-helix	378-386	9
α-helix	391-399	9
α-helix	416-446	31
β-strand	454-460	7	2
β-strand	470	1	5
α-helix	472-499	28
α-helix	515-524	10
α-helix	529-537	9
α-helix	544-555	12
β-strand	562-563	2	5
β-strand	578-582	5	5
β-strand	585-589	5	5
α-helix	594-599	6
α-helix	606-609	4
α-helix	610-612	3
α-helix	616-621	6
α-helix	645-660	16
β-strand	663-671	9	2
α-helix	684-691	8
α-helix	708	1
β-strand	709-712	4	6
α-helix	713-720	8
α-helix	735-745	11
β-strand	753-754	2	6
β-strand	759-762	4	6
α-helix	766-796	31
α-helix	800-820	21
α-helix	825-833	9

Chain Y: 8 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	15-27	13
α-helix	37-45	9
α-helix	53-60	8
α-helix	69-77	9
α-helix	86-94	9
β-strand	104-105	2	7
α-helix	106-115	10
α-helix	122-129	8
β-strand	134	1	7
β-strand	138-139	2	7
α-helix	141-148	8

Chain Z: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	5-21	17
β-strand	28-29	2	8
α-helix	33-39	7
α-helix	46-52	7
β-strand	62-63	2	8
α-helix	65-74	10
α-helix	83-91	9
β-strand	102	1	9
α-helix	103-112	10
α-helix	119-129	11
β-strand	138	1	9
α-helix	141-150	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin heavy chain	A	protein	835	Argopecten irradians	P24733 (AlphaFold model)
Myosin regulatory light chain	Y	protein	156	Argopecten irradians	P13543 (AlphaFold model)
Myosin essential light chain	Z	protein	156	Argopecten irradians	P07291 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1B7T_1 MYOSIN HEAVY CHAIN (chains A)
MNIDFSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKI
VADSSTRTVKKDDIQSMNPPKFEKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFC
IAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMVTDRENQSCLITGESGA
GKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNS
SRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVM
LVTPDSGLYSFINQGCLTVDNIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGE
MKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVKVGTEMVTKGQNMNQVV
NSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYT
NERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFP
KADDKSFQDKLYQNHMGKNRMFTKPGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKD
PINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSSAFQTISAVHRESLNKLMKNL
YSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRY
SILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSK
IISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSKVKP

Sequence of entity 2 (Y), FASTA

>1B7T_2 MYOSIN REGULATORY LIGHT CHAIN (chains Y)
ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAML
KEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNF
NKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA

Sequence of entity 3 (Z), FASTA

>1B7T_3 MYOSIN ESSENTIAL LIGHT CHAIN (chains Z)
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGE
KSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDE
DVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPDK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
CA	Calcium ion	Ca	1

Primary citation

Atomic structure of scallop myosin subfragment S1 complexed with MgADP: a novel conformation of the myosin head. Houdusse, A., Kalabokis, V.N., Himmel, D. et al. Cell (1999) 97:459-470. DOI 10.1016/S0092-8674(00)80756-4 · PubMed

Other PDB entries of the same protein (UniProt P24733 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WDC 2.0 Å, Scallop myosin regulatory domain
3JVT 2.1 Å, Calcium-bound Scallop Myosin Regulatory Domain (Lever Arm) with Reconstituted Complete…
1KK8 2.3 Å, Scallop myosin (S1-ADP-befx) in the actin-detached conformation
3BAS 2.3 Å, Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (C2) form
3BAT 2.3 Å, Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (P21)…
1QVI 2.54 Å, Crystal structure of scallop myosin S1 in the pre-power stroke state to 2.6 Angstrom…
3JTD 2.57 Å, Calcium-free Scallop Myosin Regulatory Domain with ELC-D19A Point Mutation
1SR6 2.75 Å, Structure of nucleotide-free scallop myosin S1
1L2O 2.8 Å, Scallop myosin S1-ADP-p-pdm in the actin-detached conformation
1SCM 2.8 Å, Structure of the regulatory domain of scallop myosin at 2.8 Å resolution
1KQM 3.0 Å, Scallop myosin S1-amppnp in the actin-detached conformation
1S5G 3.1 Å, Structure of Scallop myosin S1 reveals a novel nucleotide conformation

Browse structure collections

About this viewer

MolViewer shows 1B7T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.