1SCM: Regulatory domain of scallop myosin

Structure of the regulatory domain of scallop myosin at 2.8 Å resolution. Determined by X-ray diffraction at 2.8 Å resolution. Released 30 Apr 1994.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Argopecten irradians
Chains: 3
Atoms: 2,816
Mol. weight: 40.87 kDa
Ligands: CA
Released: 30 Apr 1994

Explore 1SCM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SCM contains 20 α-helices and 9 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	778-821	44
α-helix	825-833	9

Chain B: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	14-17	4
α-helix	20-27	8
β-strand	35	1	1
α-helix	37-47	11
α-helix	54-60	7
β-strand	67	1	1
α-helix	69-77	9
α-helix	88-94	7
β-strand	104-105	2	2
α-helix	106-115	10
α-helix	122-130	9
β-strand	134-135	2	2
β-strand	138-139	2	2
α-helix	141-148	8

Chain C: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
β-strand	28-29	2	3
α-helix	30-32	3
α-helix	33-38	6
α-helix	46-50	5
β-strand	62-63	2	3
α-helix	65-76	12
α-helix	83-89	7
β-strand	100-102	3	4
α-helix	103-111	9
α-helix	121-125	5
β-strand	138-140	3	4
α-helix	141-149	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin heavy chain	A	protein	60	Argopecten irradians	P24733 (AlphaFold model)
Myosin regulatory light chain	B	protein	145	Argopecten irradians	P13543 (AlphaFold model)
Myosin essential light chain	C	protein	149	Argopecten irradians	P07291 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SCM_1 MYOSIN HEAVY CHAIN (chains A)
RLSKIISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSKVKPL

Sequence of entity 2 (B), FASTA

>1SCM_2 MYOSIN REGULATORY LIGHT CHAIN (chains B)
LPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTM
FLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKE
APVEGGKFDYVKFTAMIKGSGEEEA

Sequence of entity 3 (C), FASTA

>1SCM_3 MYOSIN ESSENTIAL LIGHT CHAIN (chains C)
SQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSL
PFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVD
EIIKLTDLQEDLEGNVKYEDFVKKVMAGP

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Structure of the regulatory domain of scallop myosin at 2.8 A resolution. Xie, X., Harrison, D.H., Schlichting, I. et al. Nature (1994) 368:306-312. DOI 10.1038/368306a0 · PubMed

Other PDB entries of the same protein (UniProt P24733 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WDC 2.0 Å, Scallop myosin regulatory domain
3JVT 2.1 Å, Calcium-bound Scallop Myosin Regulatory Domain (Lever Arm) with Reconstituted Complete…
1KK8 2.3 Å, Scallop myosin (S1-ADP-befx) in the actin-detached conformation
3BAS 2.3 Å, Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (C2) form
3BAT 2.3 Å, Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (P21)…
1B7T 2.5 Å, Myosin digested by papain
1QVI 2.54 Å, Crystal structure of scallop myosin S1 in the pre-power stroke state to 2.6 Angstrom…
3JTD 2.57 Å, Calcium-free Scallop Myosin Regulatory Domain with ELC-D19A Point Mutation
1SR6 2.75 Å, Structure of nucleotide-free scallop myosin S1
1L2O 2.8 Å, Scallop myosin S1-ADP-p-pdm in the actin-detached conformation
1KQM 3.0 Å, Scallop myosin S1-amppnp in the actin-detached conformation
1S5G 3.1 Å, Structure of Scallop myosin S1 reveals a novel nucleotide conformation

Browse structure collections

About this viewer

MolViewer shows 1SCM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.