1QVI: Myosin heavy chain, striated muscle

Crystal structure of scallop myosin S1 in the pre-power stroke state to 2.6 Angstrom resolution: flexibility and function in the head. Determined by X-ray diffraction at 2.54 Å resolution. Released 16 Dec 2003.

Method: X-ray diffraction
Resolution: 2.54 Å
Organism: Argopecten irradians
Chains: 3
Atoms: 8,826
Mol. weight: 131.64 kDa
Ligands: MG, VO4, ADP, CA
Released: 16 Dec 2003

Explore 1QVI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QVI contains 58 α-helices and 39 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 41 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
β-strand	33-38	6	1
β-strand	42-50	9	1
β-strand	55-60	6	1
α-helix	61-63	3
β-strand	65-70	6	1
β-strand	75-76	2	1
α-helix	77-79	3
α-helix	80-82	3
β-strand	87	1	2
α-helix	88-90	3
α-helix	96-109	14
β-strand	113-116	4	2
β-strand	119-123	5	2
α-helix	134-140	7
α-helix	145-147	3
α-helix	152-166	15
β-strand	170-175	6	2
β-strand	177	1	3
α-helix	182-196	15
α-helix	215-230	16
β-strand	231-232	2	4
β-strand	240-241	2	4
β-strand	244-251	8	2
β-strand	257-265	9	2
α-helix	270-273	4
α-helix	283-287	5
α-helix	294-296	3
α-helix	297-300	4
α-helix	306-308	3
β-strand	319	1	5
β-strand	322	1	5
α-helix	324-337	14
α-helix	342-358	17
β-strand	363-364	2	6
β-strand	373-374	2	6
α-helix	378-387	10
α-helix	391-399	9
β-strand	402	1	7
β-strand	411	1	7
α-helix	416-446	31
β-strand	454-460	7	2
α-helix	462-463	2
β-strand	464	1	3
β-strand	470	1	8
α-helix	472-489	18
α-helix	490-495	6
α-helix	496-502	7
α-helix	517-524	8
α-helix	529-535	7
α-helix	544-555	12
β-strand	562-563	2	8
β-strand	578-582	5	8
β-strand	585-589	5	8
α-helix	594-598	5
α-helix	604-611	8
α-helix	616-621	6
α-helix	645-661	17
β-strand	664-671	8	2
α-helix	684-694	11
α-helix	696-705	10
β-strand	709-712	4	9
α-helix	713-720	8
α-helix	721-723	3
α-helix	735-745	11
α-helix	750-752	3
β-strand	753-755	3	9
β-strand	759-762	4	9
α-helix	766-796	31
α-helix	798-822	25
α-helix	827-833	7

Chain Y: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	14-27	14
β-strand	34	1	10
α-helix	37-45	9
α-helix	53-60	8
β-strand	68	1	10
α-helix	69-78	10
α-helix	86-94	9
β-strand	103-105	3	11
α-helix	106-115	10
α-helix	122-129	8
β-strand	134-135	2	11
β-strand	138-140	3	11
α-helix	141-148	8

Chain Z: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	5-20	16
β-strand	27-29	3	12
α-helix	30-32	3
α-helix	33-40	8
α-helix	46-51	6
β-strand	62-64	3	12
α-helix	65-76	12
α-helix	83-91	9
β-strand	100-102	3	13
α-helix	103-112	10
α-helix	119-128	10
β-strand	138-140	3	13
α-helix	141-150	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin heavy chain, striated muscle	A	protein	840	Argopecten irradians	P24733 (AlphaFold model)
Myosin regulatory light chain, striated adductor muscle	Y	protein	156	Argopecten irradians	P13543 (AlphaFold model)
Myosin essential light chain, striated adductor muscle	Z	protein	156	Argopecten irradians	P07291 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QVI_1 Myosin heavy chain, striated muscle (chains A)
MNIDFSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKI
VADSSTRTVKKDDIQSMNPPKFEKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFC
IAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMVTDRENQSCLITGESGA
GKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNS
SRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVM
LVTPDSGLYSFINQGCLTVDNIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGE
MKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVKVGTEMVTKGQNMNQVV
NSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYT
NERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFP
KADDKSFQDKLYQNHMGKNRMFTKPGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKD
PINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSSAFQTISAVHRESLNKLMKNL
YSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRY
SILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSK
IISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSKVKPLLSIA

Sequence of entity 2 (Y), FASTA

>1QVI_2 Myosin regulatory light chain, striated adductor muscle (chains Y)
ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAML
KEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNF
NKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA

Sequence of entity 3 (Z), FASTA

>1QVI_3 Myosin essential light chain, striated adductor muscle (chains Z)
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGE
KSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDE
DVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPDK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
VO4	Vanadate ion	O4 V	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
CA	Calcium ion	Ca	1

Primary citation

Crystal structure of scallop Myosin s1 in the pre-power stroke state to 2.6 a resolution: flexibility and function in the head. Gourinath, S., Himmel, D.M., Brown, J.H. et al. Structure (2003) 11:1621-1627. DOI 10.1016/j.str.2003.10.013 · PubMed

Other PDB entries of the same protein (UniProt P24733 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WDC 2.0 Å, Scallop myosin regulatory domain
3JVT 2.1 Å, Calcium-bound Scallop Myosin Regulatory Domain (Lever Arm) with Reconstituted Complete…
1KK8 2.3 Å, Scallop myosin (S1-ADP-befx) in the actin-detached conformation
3BAS 2.3 Å, Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (C2) form
3BAT 2.3 Å, Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (P21)…
1B7T 2.5 Å, Myosin digested by papain
3JTD 2.57 Å, Calcium-free Scallop Myosin Regulatory Domain with ELC-D19A Point Mutation
1SR6 2.75 Å, Structure of nucleotide-free scallop myosin S1
1L2O 2.8 Å, Scallop myosin S1-ADP-p-pdm in the actin-detached conformation
1SCM 2.8 Å, Structure of the regulatory domain of scallop myosin at 2.8 Å resolution
1KQM 3.0 Å, Scallop myosin S1-amppnp in the actin-detached conformation
1S5G 3.1 Å, Structure of Scallop myosin S1 reveals a novel nucleotide conformation

Browse more

1QVI is part of these collections:

Motor proteins and the cytoskeleton

About this viewer

MolViewer shows 1QVI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.