3JTD: Myosin heavy chain, striated adductor muscle

Calcium-free Scallop Myosin Regulatory Domain with ELC-D19A Point Mutation. Determined by X-ray diffraction at 2.57 Å resolution. Released 1 Dec 2009.

Method: X-ray diffraction
Resolution: 2.57 Å
Organism: Argopecten irradians
Chains: 3
Atoms: 3,029
Mol. weight: 43.31 kDa
Ligands: MG
Released: 1 Dec 2009

Explore 3JTD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JTD contains 20 α-helices and 8 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	775-822	48
α-helix	825-831	7

Chain B: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	14-27	14
α-helix	37-47	11
α-helix	56-61	6
α-helix	69-79	11
α-helix	86-94	9
β-strand	104-105	2	1
α-helix	106-115	10
α-helix	119-121	3
α-helix	122-129	8
β-strand	134-135	2	1
β-strand	138-139	2	1
α-helix	141-148	8

Chain C: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	5-21	17
β-strand	28-29	2	2
α-helix	30-32	3
α-helix	33-39	7
α-helix	46-50	5
β-strand	62-63	2	2
α-helix	65-75	11
α-helix	83-91	9
β-strand	100-102	3	3
α-helix	103-112	10
α-helix	119-128	10
β-strand	134	1	3
β-strand	138-140	3	3
α-helix	141-149	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin heavy chain, striated adductor muscle	A	protein	65	Argopecten irradians	P24733 (AlphaFold model)
Myosin regulatory light chain, striated adductor muscle	B	protein	156	Argopecten irradians	P13543 (AlphaFold model)
Myosin essential light chain, striated adductor muscle	C	protein	156	Argopecten irradians	P07291 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3JTD_1 Myosin heavy chain, striated adductor muscle (chains A)
MRDERLSKIISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSK
VKPLL

Sequence of entity 2 (B), FASTA

>3JTD_2 Myosin regulatory light chain, striated adductor muscle (chains B)
ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAML
KEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNF
NKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA

Sequence of entity 3 (C), FASTA

>3JTD_3 Myosin essential light chain, striated adductor muscle (chains C)
PKLSQDEIDDLKDVFELFAFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGE
KSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDE
DVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPDK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

The on-off switch in regulated myosins: different triggers but related mechanisms. Himmel, D.M., Mui, S., O'Neall-Hennessey, E. et al. J Mol Biol (2009) 394:496-505. DOI 10.1016/j.jmb.2009.09.035 · PubMed

Other PDB entries of the same protein (UniProt P24733 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WDC 2.0 Å, Scallop myosin regulatory domain
3JVT 2.1 Å, Calcium-bound Scallop Myosin Regulatory Domain (Lever Arm) with Reconstituted Complete…
1KK8 2.3 Å, Scallop myosin (S1-ADP-befx) in the actin-detached conformation
3BAS 2.3 Å, Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (C2) form
3BAT 2.3 Å, Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (P21)…
1B7T 2.5 Å, Myosin digested by papain
1QVI 2.54 Å, Crystal structure of scallop myosin S1 in the pre-power stroke state to 2.6 Angstrom…
1SR6 2.75 Å, Structure of nucleotide-free scallop myosin S1
1L2O 2.8 Å, Scallop myosin S1-ADP-p-pdm in the actin-detached conformation
1SCM 2.8 Å, Structure of the regulatory domain of scallop myosin at 2.8 Å resolution
1KQM 3.0 Å, Scallop myosin S1-amppnp in the actin-detached conformation
1S5G 3.1 Å, Structure of Scallop myosin S1 reveals a novel nucleotide conformation

Browse structure collections

About this viewer

MolViewer shows 3JTD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.