1BXW: Protein

Name: PDB 1BXW: Outer membrane protein A (OMPA) transmembrane domain
Published: 1998-10-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Outer membrane protein A (OMPA) transmembrane domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 14 Oct 1998.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Escherichia coli BL21(DE3)
Chains: 1
Atoms: 1,390
Mol. weight: 19.2 kDa
Ligands: C8E
Released: 14 Oct 1998

Explore 1BXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BXW contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
α-helix	1-3	3
β-strand	7-16	10	1
β-strand	34-46	13	1
β-strand	49-60	12	1
β-strand	72-86	15	1
β-strand	91-106	16	1
β-strand	114-130	17	1
β-strand	135-144	10	1
β-strand	161-170	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (outer membrane protein A)	A	protein	172	Escherichia coli BL21(DE3)	P0A910 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BXW_1 PROTEIN (OUTER MEMBRANE PROTEIN A) (chains A)
MAPKDNTWYTGAKLGWSQYHDTGLINNNGPTHENKLGAGAFGGYQVNPYVGFEMGYDWLG
RMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGV
SPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFG

Ligands and cofactors

ID	Name	Formula	Copies
C8E	(hydroxyethyloxy)tri(ethyloxy)octane	C16 H34 O5	1

Primary citation

Structure of the outer membrane protein A transmembrane domain. Pautsch, A., Schulz, G.E. Nat Struct Biol (1998) 5:1013-1017. DOI 10.1038/2983 · PubMed

Other PDB entries of the same protein (UniProt P0A910 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QJP 1.65 Å, High resolution structure of the outer membrane protein A (OMPA) transmembrane domain
5M2Q 1.7 Å, Structure of cobinamide-bound BtuF mutant W66F, the periplasmic vitamin B12 binding…
9FZC 2.27 Å, Structure of OmpA-short in complex with nanobody Nb01
6LYR 3.28 Å, Structure of the BAM complex
6ITC 3.45 Å, Structure of a substrate engaged SecA-SecY protein translocation machine
3JBU 3.64 Å, Mechanisms of Ribosome Stalling by SecM at Multiple Elongation Steps
3NB3 19.0 Å, The host outer membrane proteins OmpA and OmpC are packed at specific sites in the…
1G90 NMR Solution Structure of Outer Membrane Protein A Transmembrane Domain: 10 conformers
2GE4 High-resolution solution structure of outer membrane protein A transmembrane domain
2JMM NMR solution structure of a minimal transmembrane beta-barrel platform protein
2MQE Solution structure of Escherichia coli Outer membrane protein A C-terminal domain
9A2M Model of E. coli OmpA by in-cell photo-crosslinking MS and deep learning

Browse more

1BXW is part of these collections:

Membrane proteins and transporters

About this viewer

MolViewer shows 1BXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.