2JMM: Outer membrane protein A

Name: PDB 2JMM: NMR solution structure of a minimal transmembrane beta-barrel platform protein
Published: 2007-07-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

NMR solution structure of a minimal transmembrane beta-barrel platform protein. Determined by solution NMR. Released 3 Jul 2007.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 1,213
Mol. weight: 17.2 kDa
Released: 3 Jul 2007

Explore 2JMM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JMM contains 1 α-helix and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	6-16	11	1
β-strand	25-33	9	1
β-strand	38-47	10	1
β-strand	54-65	12	1
β-strand	74-84	11	1
β-strand	87	1	2
β-strand	101	1	2
α-helix	102-104	3
β-strand	106-115	10	1
β-strand	124-133	10	1
β-strand	139-149	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein A	A	protein	156	Escherichia coli	P0A910 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JMM_1 Outer membrane protein A (chains A)
MPKDNTWYTGAKLGWSQYSRENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPRKAQGVQLT
AKLGYPKLGTDDLDIYTRLGGMVWRADTSDKDGNGYISAAEASVSPVFAGGVEYVIRRRI
TPEIATRLEYQWTNNASDNGMLSLGVSYRFGQGEAA

Primary citation

A minimal transmembrane beta-barrel platform protein studied by nuclear magnetic resonance. Johansson, M.U., Alioth, S., Hu, K. et al. Biochemistry (2007) 46:1128-1140. DOI 10.1021/bi061265e · PubMed

Other PDB entries of the same protein (UniProt P0A910 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QJP 1.65 Å, High resolution structure of the outer membrane protein A (OMPA) transmembrane domain
5M2Q 1.7 Å, Structure of cobinamide-bound BtuF mutant W66F, the periplasmic vitamin B12 binding…
9FZC 2.27 Å, Structure of OmpA-short in complex with nanobody Nb01
1BXW 2.5 Å, Outer membrane protein A (OMPA) transmembrane domain
6LYR 3.28 Å, Structure of the BAM complex
6ITC 3.45 Å, Structure of a substrate engaged SecA-SecY protein translocation machine
3JBU 3.64 Å, Mechanisms of Ribosome Stalling by SecM at Multiple Elongation Steps
3NB3 19.0 Å, The host outer membrane proteins OmpA and OmpC are packed at specific sites in the…
1G90 NMR Solution Structure of Outer Membrane Protein A Transmembrane Domain: 10 conformers
2GE4 High-resolution solution structure of outer membrane protein A transmembrane domain
2MQE Solution structure of Escherichia coli Outer membrane protein A C-terminal domain
9A2M Model of E. coli OmpA by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 2JMM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.