2GE4: Outer membrane protein A transmembrane domain

Name: PDB 2GE4: High-resolution solution structure of outer membrane protein A transmembrane domain
Published: 2006-04-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

High-resolution solution structure of outer membrane protein A transmembrane domain. Determined by solution NMR. Released 11 Apr 2006.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 1,354
Mol. weight: 19.19 kDa
Released: 11 Apr 2006

Explore 2GE4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GE4 contains 0 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6-16	11	1
β-strand	34-44	11	1
β-strand	50-55	6	1
β-strand	75-85	11	1
β-strand	91-103	13	1
β-strand	118-132	15	1
β-strand	135-142	8	1
β-strand	161-170	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein A	A	protein	177	Escherichia coli	P0A910 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2GE4_1 Outer membrane protein A (chains A)
MAPKDNTWYTGAKLGFSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDFLG
RMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVFRADTKSNVYGKNHDTGV
SPVFAGGVEYAITPEIATRLEYQFTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAA

Primary citation

Increasing the accuracy of solution NMR structures of membrane proteins by application of residual dipolar couplings. High-resolution structure of outer membrane protein A. Cierpicki, T., Liang, B., Tamm, L.K. et al. J Am Chem Soc (2006) 128:6947-6951. DOI 10.1021/ja0608343 · PubMed

Other PDB entries of the same protein (UniProt P0A910 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QJP 1.65 Å, High resolution structure of the outer membrane protein A (OMPA) transmembrane domain
5M2Q 1.7 Å, Structure of cobinamide-bound BtuF mutant W66F, the periplasmic vitamin B12 binding…
9FZC 2.27 Å, Structure of OmpA-short in complex with nanobody Nb01
1BXW 2.5 Å, Outer membrane protein A (OMPA) transmembrane domain
6LYR 3.28 Å, Structure of the BAM complex
6ITC 3.45 Å, Structure of a substrate engaged SecA-SecY protein translocation machine
3JBU 3.64 Å, Mechanisms of Ribosome Stalling by SecM at Multiple Elongation Steps
3NB3 19.0 Å, The host outer membrane proteins OmpA and OmpC are packed at specific sites in the…
1G90 NMR Solution Structure of Outer Membrane Protein A Transmembrane Domain: 10 conformers
2JMM NMR solution structure of a minimal transmembrane beta-barrel platform protein
2MQE Solution structure of Escherichia coli Outer membrane protein A C-terminal domain
9A2M Model of E. coli OmpA by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 2GE4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.