1QJP: Outer membrane protein A

Name: PDB 1QJP: High resolution structure of the outer membrane protein A (OMPA) transmembrane domain
Published: 2000-06-30
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: outer membrane

High resolution structure of the outer membrane protein A (OMPA) transmembrane domain. Determined by X-ray diffraction at 1.65 Å resolution. Released 30 Jun 2000.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: ESCHERICHIA COLI BL21(DE3)
Chains: 1
Atoms: 1,291
Mol. weight: 20.63 kDa
Ligands: C8E
Released: 30 Jun 2000

Explore 1QJP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QJP contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	6-16	11	1
β-strand	34-46	13	1
β-strand	49-60	12	1
α-helix	61-62	2
β-strand	72-86	15	1
β-strand	91-107	17	1
β-strand	113-132	20	1
β-strand	135-144	10	1
β-strand	161-169	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein A	A	protein	171	ESCHERICHIA COLI BL21(DE3)	P0A910 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QJP_1 OUTER MEMBRANE PROTEIN A (chains A)
APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENKLGAGAFGGYQVNPYVGFEMGYDWLGR
MPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVS
PVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFG

Ligands and cofactors

ID	Name	Formula	Copies
C8E	(hydroxyethyloxy)tri(ethyloxy)octane	C16 H34 O5	6

Primary citation

High Resolution Structure of the Ompa Membrane Domain. Pautsch, A., Schulz, G.E. J Mol Biol (2000) 298:273. DOI 10.1006/JMBI.2000.3671 · PubMed

Other PDB entries of the same protein (UniProt P0A910 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M2Q 1.7 Å, Structure of cobinamide-bound BtuF mutant W66F, the periplasmic vitamin B12 binding…
9FZC 2.27 Å, Structure of OmpA-short in complex with nanobody Nb01
1BXW 2.5 Å, Outer membrane protein A (OMPA) transmembrane domain
6LYR 3.28 Å, Structure of the BAM complex
6ITC 3.45 Å, Structure of a substrate engaged SecA-SecY protein translocation machine
3JBU 3.64 Å, Mechanisms of Ribosome Stalling by SecM at Multiple Elongation Steps
3NB3 19.0 Å, The host outer membrane proteins OmpA and OmpC are packed at specific sites in the…
1G90 NMR Solution Structure of Outer Membrane Protein A Transmembrane Domain: 10 conformers
2GE4 High-resolution solution structure of outer membrane protein A transmembrane domain
2JMM NMR solution structure of a minimal transmembrane beta-barrel platform protein
2MQE Solution structure of Escherichia coli Outer membrane protein A C-terminal domain
9A2M Model of E. coli OmpA by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 1QJP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.