1G90: Outer membrane protein A

Name: PDB 1G90: NMR Solution Structure of Outer Membrane Protein A Transmembrane Domain: 10 conformers
Published: 2001-04-21
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

NMR Solution Structure of Outer Membrane Protein A Transmembrane Domain: 10 conformers. Determined by solution NMR. Released 21 Apr 2001.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 1,347
Mol. weight: 19.06 kDa
Released: 21 Apr 2001

Explore 1G90 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1G90 contains 0 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-16	12	1
β-strand	25	1	2
β-strand	34-45	12	1
β-strand	49-57	9	1
β-strand	75-86	12	1
β-strand	91-103	13	1
β-strand	109	1	3
β-strand	112	1	3
β-strand	117-132	16	1
β-strand	135-142	8	1
β-strand	150	1	2
β-strand	161-169	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein A	A	protein	176	Escherichia coli	P0A910 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1G90_1 OUTER MEMBRANE PROTEIN A (chains A)
APKDNTWYTGAKLGFSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDFLGR
MPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVFRADTKSNVYGKNHDTGVS
PVFAGGVEYAITPEIATRLEYQFTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAA

Primary citation

Structure of outer membrane protein A transmembrane domain by NMR spectroscopy. Arora, A., Abildgaard, F., Bushweller, J.H. et al. Nat Struct Biol (2001) 8:334-338. DOI 10.1038/86214 · PubMed

Other PDB entries of the same protein (UniProt P0A910 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QJP 1.65 Å, High resolution structure of the outer membrane protein A (OMPA) transmembrane domain
5M2Q 1.7 Å, Structure of cobinamide-bound BtuF mutant W66F, the periplasmic vitamin B12 binding…
9FZC 2.27 Å, Structure of OmpA-short in complex with nanobody Nb01
1BXW 2.5 Å, Outer membrane protein A (OMPA) transmembrane domain
6LYR 3.28 Å, Structure of the BAM complex
6ITC 3.45 Å, Structure of a substrate engaged SecA-SecY protein translocation machine
3JBU 3.64 Å, Mechanisms of Ribosome Stalling by SecM at Multiple Elongation Steps
3NB3 19.0 Å, The host outer membrane proteins OmpA and OmpC are packed at specific sites in the…
2GE4 High-resolution solution structure of outer membrane protein A transmembrane domain
2JMM NMR solution structure of a minimal transmembrane beta-barrel platform protein
2MQE Solution structure of Escherichia coli Outer membrane protein A C-terminal domain
9A2M Model of E. coli OmpA by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 1G90 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.