9A2M: P0A910

Model of E. coli OmpA by in-cell photo-crosslinking MS and deep learning. Released 24 Feb 2023.

Chains

1

Atoms

2,624

Mol. weight

43.45 kDa

Released

24 Feb 2023

Explore 9A2M in 3D Show helices and sheets RCSB PDB PDBe

Molecules and chains

>9A2M_1 P0A910 (chains A)
MKKTAIAIAVALAGFATVAQAAPKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGA
FGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGG
MVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDN
GMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQ
LYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGM
GESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

Primary citation

Protein structure prediction with in-cell photo-crosslinking mass spectrometry and deep learning. Stahl, K., Graziadei, A., Dau, T. et al. Nature Biotechnology (2023). DOI 10.1038/s41587-023-01704-z · PubMed

Related structures

Other PDB entries of the same protein (UniProt P0A910 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 1QJP 1.65 Å, High resolution structure of the outer membrane protein A (OMPA) transmembrane domain
• 5M2Q 1.7 Å, Structure of cobinamide-bound BtuF mutant W66F, the periplasmic vitamin B12 binding…
• 9FZC 2.27 Å, Structure of OmpA-short in complex with nanobody Nb01
• 1BXW 2.5 Å, Outer membrane protein A (OMPA) transmembrane domain
• 6LYR 3.28 Å, Structure of the BAM complex
• 6ITC 3.45 Å, Structure of a substrate engaged SecA-SecY protein translocation machine
• 3JBU 3.64 Å, Mechanisms of Ribosome Stalling by SecM at Multiple Elongation Steps
• 3NB3 19.0 Å, The host outer membrane proteins OmpA and OmpC are packed at specific sites in the…
• 1G90 NMR Solution Structure of Outer Membrane Protein A Transmembrane Domain: 10 conformers
• 2GE4 High-resolution solution structure of outer membrane protein A transmembrane domain
• 2JMM NMR solution structure of a minimal transmembrane beta-barrel platform protein
• 2MQE Solution structure of Escherichia coli Outer membrane protein A C-terminal domain

Browse structure collections

About this viewer

MolViewer shows 9A2M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.