Fhua from E. Coli. Determined by X-ray diffraction at 2.74 Å resolution. Released 13 Jan 1999.
Explore 1BY3 in 3D Show helices and sheets RCSB PDB PDBe
1BY3 contains 14 α-helices and 45 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-27 | 6 | |
| α-helix | 29-31 | 3 | |
| β-strand | 32-33 | 2 | 1 |
| β-strand | 41-42 | 2 | 1 |
| α-helix | 43-45 | 3 | |
| β-strand | 50-54 | 5 | 2 |
| α-helix | 55-61 | 7 | |
| α-helix | 67-70 | 4 | |
| β-strand | 76-77 | 2 | 3 |
| β-strand | 91-92 | 2 | 3 |
| β-strand | 95 | 1 | 3 |
| α-helix | 98-100 | 3 | |
| β-strand | 104-105 | 2 | 2 |
| β-strand | 110 | 1 | 2 |
| β-strand | 114 | 1 | 4 |
| β-strand | 117 | 1 | 4 |
| α-helix | 123-125 | 3 | |
| β-strand | 126-133 | 8 | 2 |
| α-helix | 137-140 | 4 | |
| β-strand | 147-153 | 7 | 2 |
| α-helix | 154 | 1 | |
| β-strand | 161-169 | 9 | 5 |
| β-strand | 173-183 | 11 | 5 |
| β-strand | 190-202 | 13 | 5 |
| β-strand | 209-221 | 13 | 5 |
| β-strand | 227-238 | 12 | 5 |
| β-strand | 241 | 1 | 5 |
| β-strand | 247 | 1 | 6 |
| β-strand | 250 | 1 | 7 |
| β-strand | 254 | 1 | 7 |
| β-strand | 274-289 | 16 | 5 |
| β-strand | 294-317 | 24 | 5 |
| α-helix | 321-323 | 3 | |
| α-helix | 327-330 | 4 | |
| α-helix | 336-338 | 3 | |
| β-strand | 340-367 | 28 | 5 |
| β-strand | 370-392 | 23 | 5 |
| β-strand | 400-401 | 2 | 5 |
| β-strand | 420-442 | 23 | 5 |
| β-strand | 445-462 | 18 | 5 |
| β-strand | 468-484 | 17 | 5 |
| β-strand | 490-501 | 12 | 5 |
| β-strand | 506 | 1 | 8 |
| β-strand | 512 | 1 | 8 |
| α-helix | 513-515 | 3 | |
| β-strand | 516-527 | 12 | 5 |
| β-strand | 535-551 | 17 | 5 |
| β-strand | 559-579 | 21 | 5 |
| β-strand | 582-597 | 16 | 5 |
| β-strand | 612-622 | 11 | 5 |
| β-strand | 630-639 | 10 | 5 |
| β-strand | 642-643 | 2 | 9 |
| β-strand | 651-652 | 2 | 9 |
| β-strand | 655-665 | 11 | 5 |
| β-strand | 675-681 | 7 | 5 |
| β-strand | 689-694 | 6 | 6 |
| β-strand | 697-700 | 4 | 6 |
| α-helix | 702-704 | 3 | |
| β-strand | 705-713 | 9 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (ferrichrome-iron receptor precursor (fhua)) | A | protein | 714 | Escherichia coli | P06971 (AlphaFold model) |
>1BY3_1 PROTEIN (FERRICHROME-IRON RECEPTOR PRECURSOR (FHUA)) (chains A) AVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMAL HQPKSVKEALSYTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAV IDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDF SDSLDDDGVYSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPE TGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNL RFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQ LQSKFATGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLNLYNPVNTDFDFNAKDPANS GPYRILNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRG GVNYLFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAV YNLTKTNNLMADPEGSFFSVEGGEIRARGVEIEAKRPLSASVNVVGSYTYTDAEYTTDTT YKGNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDA LVRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF
| ID | Name | Formula | Copies |
|---|---|---|---|
| OES | N-octyl-2-hydroxyethyl sulfoxide | C10 H22 O2 S | 7 |
Transmembrane signaling across the ligand-gated FhuA receptor: crystal structures of free and ferrichrome-bound states reveal allosteric changes. Locher, K.P., Rees, B., Koebnik, R. et al. Cell (1998) 95:771-778. DOI 10.1016/S0092-8674(00)81700-6 · PubMed
Other PDB entries of the same protein (UniProt P06971 (AlphaFold model), which also has an AlphaFold model), best resolution first:
1BY3 is part of these collections:
MolViewer shows 1BY3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.