Escherichia coli ferric hydroxamate uptake receptor (FHUA) in complex delta two-albomycin. Determined by X-ray diffraction at 3.1 Å resolution. Released 5 Jun 2000.
Explore 1QKC in 3D Show helices and sheets RCSB PDB PDBe
1QKC contains 11 α-helices and 47 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 32-33 | 2 | 1 |
| β-strand | 41-42 | 2 | 1 |
| α-helix | 43-45 | 3 | |
| β-strand | 50-53 | 4 | 2 |
| α-helix | 55-61 | 7 | |
| β-strand | 76-77 | 2 | 3 |
| β-strand | 91-92 | 2 | 3 |
| β-strand | 95 | 1 | 3 |
| α-helix | 98-100 | 3 | |
| β-strand | 104-106 | 3 | 2 |
| β-strand | 110 | 1 | 2 |
| β-strand | 114 | 1 | 4 |
| β-strand | 117 | 1 | 4 |
| α-helix | 123-125 | 3 | |
| β-strand | 126-132 | 7 | 2 |
| α-helix | 137-140 | 4 | |
| β-strand | 148-153 | 6 | 2 |
| β-strand | 161-166 | 6 | 5 |
| β-strand | 169 | 1 | 5 |
| β-strand | 173-181 | 9 | 5 |
| β-strand | 183 | 1 | 5 |
| β-strand | 190-202 | 13 | 5 |
| β-strand | 209-221 | 13 | 5 |
| β-strand | 227-238 | 12 | 5 |
| β-strand | 241 | 1 | 5 |
| β-strand | 247 | 1 | 6 |
| β-strand | 250 | 1 | 7 |
| β-strand | 254 | 1 | 7 |
| β-strand | 274-289 | 16 | 5 |
| β-strand | 294-317 | 24 | 5 |
| α-helix | 321-325 | 5 | |
| α-helix | 337-339 | 3 | |
| β-strand | 340-367 | 28 | 5 |
| β-strand | 370-392 | 23 | 5 |
| β-strand | 397-401 | 5 | 5 |
| β-strand | 431-452 | 22 | 5 |
| β-strand | 456-473 | 18 | 5 |
| β-strand | 478-495 | 18 | 5 |
| β-strand | 501-512 | 12 | 5 |
| β-strand | 517 | 1 | 8 |
| β-strand | 523 | 1 | 8 |
| α-helix | 524-526 | 3 | |
| β-strand | 527-538 | 12 | 5 |
| β-strand | 546-567 | 22 | 5 |
| β-strand | 569-587 | 19 | 5 |
| β-strand | 593-608 | 16 | 5 |
| α-helix | 615-617 | 3 | |
| β-strand | 623-633 | 11 | 5 |
| β-strand | 641-650 | 10 | 5 |
| β-strand | 653-654 | 2 | 9 |
| β-strand | 662-663 | 2 | 9 |
| α-helix | 664-665 | 2 | |
| β-strand | 666-676 | 11 | 5 |
| α-helix | 677-680 | 4 | |
| β-strand | 686-692 | 7 | 5 |
| β-strand | 700-705 | 6 | 6 |
| β-strand | 708-711 | 4 | 6 |
| β-strand | 716-724 | 9 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ferric hydroxamate receptor | A | protein | 725 | Escherichia coli K-12 | P06971 (AlphaFold model) |
>1QKC_1 FERRIC HYDROXAMATE RECEPTOR (chains A) AVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMAL HQPKSVKEALSYTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAV IDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDF SDSLDDDGVYSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPE TGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNL RFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQ LQSKFATGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLNLYNPSSHHHHHHGSSVNTD FDFNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTD KRDDKQFTWRGGVNYLFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVP EDRPIVVTGAVYNLTKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYT YTDAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANS FKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVAT ATFRF
| ID | Name | Formula | Copies |
|---|---|---|---|
| FTT | 3-hydroxy-tetradecanoic acid | C14 H28 O3 | 6 |
| DPO | Diphosphate | O7 P2 | 2 |
| PO4 | Phosphate ion | O4 P | 2 |
| NI | Nickel (II) ion | Ni | 1 |
| ALB | Delta-2-albomycin A1 | C37 H57 Fe N12 O18 S | 1 |
Crystal structure of the antibiotic albomycin in complex with the outer membrane transporter FhuA. Ferguson, A.D., Braun, V., Fiedler, H.P. et al. Protein Sci (2000) 9:956-963. DOI 10.1110/ps.9.5.956 · PubMed
Other PDB entries of the same protein (UniProt P06971 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1QKC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.