1QKC: Ferric hydroxamate receptor

Escherichia coli ferric hydroxamate uptake receptor (FHUA) in complex delta two-albomycin. Determined by X-ray diffraction at 3.1 Å resolution. Released 5 Jun 2000.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Escherichia coli K-12
Chains: 1
Atoms: 6,195
Mol. weight: 85.15 kDa
Ligands: FTT, DPO, PO4, NI
Released: 5 Jun 2000

Explore 1QKC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QKC contains 11 α-helices and 47 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 47 β-strands

Element	Residues	Length	Sheet
β-strand	32-33	2	1
β-strand	41-42	2	1
α-helix	43-45	3
β-strand	50-53	4	2
α-helix	55-61	7
β-strand	76-77	2	3
β-strand	91-92	2	3
β-strand	95	1	3
α-helix	98-100	3
β-strand	104-106	3	2
β-strand	110	1	2
β-strand	114	1	4
β-strand	117	1	4
α-helix	123-125	3
β-strand	126-132	7	2
α-helix	137-140	4
β-strand	148-153	6	2
β-strand	161-166	6	5
β-strand	169	1	5
β-strand	173-181	9	5
β-strand	183	1	5
β-strand	190-202	13	5
β-strand	209-221	13	5
β-strand	227-238	12	5
β-strand	241	1	5
β-strand	247	1	6
β-strand	250	1	7
β-strand	254	1	7
β-strand	274-289	16	5
β-strand	294-317	24	5
α-helix	321-325	5
α-helix	337-339	3
β-strand	340-367	28	5
β-strand	370-392	23	5
β-strand	397-401	5	5
β-strand	431-452	22	5
β-strand	456-473	18	5
β-strand	478-495	18	5
β-strand	501-512	12	5
β-strand	517	1	8
β-strand	523	1	8
α-helix	524-526	3
β-strand	527-538	12	5
β-strand	546-567	22	5
β-strand	569-587	19	5
β-strand	593-608	16	5
α-helix	615-617	3
β-strand	623-633	11	5
β-strand	641-650	10	5
β-strand	653-654	2	9
β-strand	662-663	2	9
α-helix	664-665	2
β-strand	666-676	11	5
α-helix	677-680	4
β-strand	686-692	7	5
β-strand	700-705	6	6
β-strand	708-711	4	6
β-strand	716-724	9	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferric hydroxamate receptor	A	protein	725	Escherichia coli K-12	P06971 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QKC_1 FERRIC HYDROXAMATE RECEPTOR (chains A)
AVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMAL
HQPKSVKEALSYTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAV
IDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDF
SDSLDDDGVYSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPE
TGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNL
RFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQ
LQSKFATGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLNLYNPSSHHHHHHGSSVNTD
FDFNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTD
KRDDKQFTWRGGVNYLFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVP
EDRPIVVTGAVYNLTKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYT
YTDAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANS
FKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVAT
ATFRF

Ligands and cofactors

ID	Name	Formula	Copies
FTT	3-hydroxy-tetradecanoic acid	C14 H28 O3	6
DPO	Diphosphate	O7 P2	2
PO4	Phosphate ion	O4 P	2
NI	Nickel (II) ion	Ni	1
ALB	Delta-2-albomycin A1	C37 H57 Fe N12 O18 S	1

Primary citation

Crystal structure of the antibiotic albomycin in complex with the outer membrane transporter FhuA. Ferguson, A.D., Braun, V., Fiedler, H.P. et al. Protein Sci (2000) 9:956-963. DOI 10.1110/ps.9.5.956 · PubMed

Other PDB entries of the same protein (UniProt P06971 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CU4 2.3 Å, FhuA from E. coli in complex with the lasso peptide microcin J25 (MccJ25)
1QFG 2.5 Å, E. Coli ferric hydroxamate receptor (FHUA)
2FCP 2.5 Å, Ferric hydroxamate uptake receptor (FHUA) from e.coli
1BY5 2.6 Å, Fhua from E. Coli, with its ligand ferrichrome
8B14 2.6 Å, T5 Receptor Binding Protein pb5 in complex with its E. coli receptor FhuA
1FCP 2.7 Å, Ferric hydroxamate uptake receptor (FHUA) from e.coli in complex with bound…
1QFF 2.7 Å, E. Coli ferric hydroxamate uptake receptor (FHUA) in complex with bound ferrichrome-iron
1BY3 2.74 Å, Fhua from E. Coli
1FI1 2.9 Å, FhuA in complex with lipopolysaccharide and rifamycin CGP4832
1QJQ 2.95 Å, Ferric hydroxamate receptor from escherichia coli (FHUA)
8A8C 3.1 Å, T5 phage receptor-binding protein pb5 bound to ferrichrome transporter FhuA
2GRX 3.3 Å, Crystal structure of TonB in complex with FhuA, E. coli outer membrane receptor for…

Browse structure collections

About this viewer

MolViewer shows 1QKC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.