Ferric hydroxamate uptake receptor (FHUA) from e.coli in complex with bound ferrichrome-iron. Determined by X-ray diffraction at 2.7 Å resolution. Released 13 Jan 1999.
Explore 1FCP in 3D Show helices and sheets RCSB PDB PDBe
1FCP contains 13 α-helices and 44 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 32-33 | 2 | 1 |
| β-strand | 41-42 | 2 | 1 |
| α-helix | 43-45 | 3 | |
| β-strand | 50-54 | 5 | 2 |
| α-helix | 55-61 | 7 | |
| α-helix | 68-70 | 3 | |
| β-strand | 76-77 | 2 | 3 |
| β-strand | 91-92 | 2 | 3 |
| β-strand | 95 | 1 | 3 |
| α-helix | 98-100 | 3 | |
| β-strand | 104-106 | 3 | 2 |
| β-strand | 109-110 | 2 | 2 |
| β-strand | 114 | 1 | 4 |
| β-strand | 117 | 1 | 4 |
| α-helix | 123-125 | 3 | |
| β-strand | 126-132 | 7 | 2 |
| α-helix | 137-140 | 4 | |
| β-strand | 148-153 | 6 | 2 |
| β-strand | 161-169 | 9 | 5 |
| β-strand | 173-183 | 11 | 5 |
| β-strand | 190-202 | 13 | 5 |
| β-strand | 209-224 | 16 | 5 |
| β-strand | 227-238 | 12 | 5 |
| β-strand | 247 | 1 | 6 |
| β-strand | 250 | 1 | 7 |
| β-strand | 254 | 1 | 7 |
| β-strand | 274-289 | 16 | 5 |
| β-strand | 294-317 | 24 | 5 |
| α-helix | 321-323 | 3 | |
| α-helix | 327-330 | 4 | |
| β-strand | 340-366 | 27 | 5 |
| β-strand | 371-392 | 22 | 5 |
| β-strand | 400-401 | 2 | 5 |
| β-strand | 429-450 | 22 | 5 |
| β-strand | 454-471 | 18 | 5 |
| β-strand | 477-493 | 17 | 5 |
| β-strand | 499-510 | 12 | 5 |
| β-strand | 515 | 1 | 8 |
| β-strand | 521 | 1 | 8 |
| α-helix | 522-524 | 3 | |
| β-strand | 525-536 | 12 | 5 |
| β-strand | 543-565 | 23 | 5 |
| β-strand | 567-585 | 19 | 5 |
| β-strand | 591-606 | 16 | 5 |
| α-helix | 613-615 | 3 | |
| β-strand | 621-631 | 11 | 5 |
| β-strand | 639-648 | 10 | 5 |
| β-strand | 651-652 | 2 | 9 |
| β-strand | 660-661 | 2 | 9 |
| α-helix | 662-663 | 2 | |
| β-strand | 664-674 | 11 | 5 |
| α-helix | 675-678 | 4 | |
| β-strand | 684-690 | 7 | 5 |
| β-strand | 698-703 | 6 | 6 |
| β-strand | 706-709 | 4 | 6 |
| α-helix | 711-713 | 3 | |
| β-strand | 714-722 | 9 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (ferric hydroxamate uptake receptor) | A | protein | 705 | Escherichia coli | P06971 (AlphaFold model) |
>1FCP_1 PROTEIN (FERRIC HYDROXAMATE UPTAKE RECEPTOR) (chains A) ESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSV GTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAEIMRGPVSV LYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDSLDDDGVYSYRLTGLA RSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLPKEGTVEPLPN GKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVC SDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGV DFMRMRNDINAWFGYDDSVPLLNLYNPSHHHHHHGSVNTDFDFNAKDPANSGPYRILNKQ KQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNYLFDNG VTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTNNL MADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPAQV PKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDALVRYDLARV GMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF
| ID | Name | Formula | Copies |
|---|---|---|---|
| FCI | Ferricrocin-iron | C28 H44 Fe N9 O13 | 1 |
| EA2 | Aminoethanolpyrophosphate | C2 H9 N O7 P2 | 1 |
| LIM | 3-oxo-pentadecanoic acid | C15 H28 O3 | 1 |
| AAE | Acetoacetic acid | C4 H6 O3 | 1 |
| LIL | 2-tridecanoyloxy-pentadecanoic acid | C28 H54 O4 | 2 |
| NI | Nickel (II) ion | Ni | 2 |
Siderophore-mediated iron transport: crystal structure of FhuA with bound lipopolysaccharide. Ferguson, A.D., Hofmann, E., Coulton, J.W. et al. Science (1998) 282:2215-2220. DOI 10.1126/science.282.5397.2215 · PubMed
Other PDB entries of the same protein (UniProt P06971 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1FCP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.