1FI1: FhuA

FhuA in complex with lipopolysaccharide and rifamycin CGP4832. Determined by X-ray diffraction at 2.9 Å resolution. Released 29 Aug 2001.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Escherichia coli K12
Chains: 1
Atoms: 6,030
Mol. weight: 83.47 kDa
Ligands: FTT, PO4, NI, MG
Released: 29 Aug 2001

Explore 1FI1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FI1 contains 14 α-helices and 45 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 45 β-strands

Element	Residues	Length	Sheet
α-helix	24-29	6
β-strand	32-33	2	1
β-strand	41-42	2	1
α-helix	43-45	3
β-strand	50-54	5	2
α-helix	55-61	7
α-helix	66-69	4
β-strand	76-77	2	3
β-strand	91-92	2	3
β-strand	95	1	3
α-helix	98-100	3
β-strand	104-106	3	2
β-strand	109-110	2	2
β-strand	114	1	4
β-strand	117	1	4
α-helix	123-125	3
β-strand	126-133	8	2
α-helix	137-140	4
β-strand	147-153	7	2
β-strand	161-169	9	5
α-helix	170-172	3
β-strand	173-183	11	5
β-strand	190-202	13	5
β-strand	209-221	13	5
β-strand	227-238	12	5
β-strand	247	1	6
β-strand	250	1	7
β-strand	254	1	7
β-strand	274-289	16	5
β-strand	294-317	24	5
α-helix	321-323	3
α-helix	327-330	4
α-helix	337-339	3
β-strand	340-366	27	5
β-strand	371-401	31	5
β-strand	409	1	8
β-strand	412	1	8
β-strand	431-452	22	5
β-strand	457-473	17	5
β-strand	478-494	17	5
β-strand	501-512	12	5
β-strand	517	1	9
β-strand	523	1	9
α-helix	524-526	3
β-strand	527-538	12	5
β-strand	545-562	18	5
β-strand	570-588	19	5
β-strand	593-608	16	5
β-strand	623-632	10	5
β-strand	641-650	10	5
β-strand	653-654	2	10
β-strand	662-663	2	10
α-helix	664-665	2
β-strand	666-675	10	5
α-helix	677-680	4
β-strand	686-692	7	5
β-strand	700-703	4	6
β-strand	709-711	3	6
β-strand	716-724	9	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferrichrome-iron receptor	A	protein	707	Escherichia coli K12	P06971 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FI1_1 FERRICHROME-IRON RECEPTOR (chains A)
ESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSV
GTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAEIMRGPVSV
LYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDSLDDDGVYSYRLTGLA
RSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLPKEGTVEPLPN
GKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVC
SDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGV
DFMRMRNDINAWFGYDDSVPLLNLYNPSSHHHHHHGSSVNTDFDFNAKDPANSGPYRILN
KQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNYLFD
NGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTN
NLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPA
QVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDALVRYDLA
RVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF

Ligands and cofactors

ID	Name	Formula	Copies
FTT	3-hydroxy-tetradecanoic acid	C14 H28 O3	6
PO4	Phosphate ion	O4 P	2
NI	Nickel (II) ion	Ni	1
MG	Magnesium ion	Mg	1
DPO	Diphosphate	O7 P2	2
RIF	Rifamycin cgp 4832	C49 H65 N3 O15	1
DDQ	Decylamine-n,n-dimethyl-N-oxide	C12 H27 N O	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Active transport of an antibiotic rifamycin derivative by the outer-membrane protein FhuA. Ferguson, A.D., Kodding, J., Walker, G. et al. Structure (2001) 9:707-716. DOI 10.1016/S0969-2126(01)00631-1 · PubMed

Other PDB entries of the same protein (UniProt P06971 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CU4 2.3 Å, FhuA from E. coli in complex with the lasso peptide microcin J25 (MccJ25)
1QFG 2.5 Å, E. Coli ferric hydroxamate receptor (FHUA)
2FCP 2.5 Å, Ferric hydroxamate uptake receptor (FHUA) from e.coli
1BY5 2.6 Å, Fhua from E. Coli, with its ligand ferrichrome
8B14 2.6 Å, T5 Receptor Binding Protein pb5 in complex with its E. coli receptor FhuA
1FCP 2.7 Å, Ferric hydroxamate uptake receptor (FHUA) from e.coli in complex with bound…
1QFF 2.7 Å, E. Coli ferric hydroxamate uptake receptor (FHUA) in complex with bound ferrichrome-iron
1BY3 2.74 Å, Fhua from E. Coli
1QJQ 2.95 Å, Ferric hydroxamate receptor from escherichia coli (FHUA)
1QKC 3.1 Å, Escherichia coli ferric hydroxamate uptake receptor (FHUA) in complex delta two-albomycin
8A8C 3.1 Å, T5 phage receptor-binding protein pb5 bound to ferrichrome transporter FhuA
2GRX 3.3 Å, Crystal structure of TonB in complex with FhuA, E. coli outer membrane receptor for…

Browse structure collections

About this viewer

MolViewer shows 1FI1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.