4CU4: FhuA from E. coli

FhuA from E. coli in complex with the lasso peptide microcin J25 (MccJ25). Determined by X-ray diffraction at 2.3 Å resolution. Released 9 Apr 2014.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: ESCHERICHIA COLI STR. K-12 SUBSTR. MG1655, ESCHERICHIA COLI STR. K-12 SUBSTR. MC4100
Chains: 2
Atoms: 6,260
Mol. weight: 88.63 kDa
Ligands: FTT, DAO, MYR, LDA
Released: 9 Apr 2014

Explore 4CU4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CU4 contains 17 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 43 β-strands

Element	Residues	Length	Sheet
α-helix	22-27	6
α-helix	29-31	3
β-strand	32-33	2	1
β-strand	41-42	2	1
α-helix	43-45	3
β-strand	50-54	5	2
α-helix	55-61	7
α-helix	66-69	4
β-strand	76-77	2	3
β-strand	91-92	2	3
β-strand	95	1	3
α-helix	98-100	3
β-strand	104-106	3	2
β-strand	109-110	2	2
β-strand	114	1	4
β-strand	117	1	4
α-helix	123-125	3
β-strand	126-133	8	2
α-helix	137-140	4
β-strand	147-153	7	2
β-strand	161-169	9	5
β-strand	173-183	11	5
β-strand	190-202	13	5
β-strand	209-224	16	5
β-strand	227-238	12	5
β-strand	247	1	6
β-strand	250	1	7
β-strand	254	1	7
α-helix	255-256	2
β-strand	274-289	16	5
β-strand	294-317	24	5
α-helix	321-323	3
α-helix	327-331	5
α-helix	337-339	3
β-strand	340-367	28	5
β-strand	370-401	32	5
β-strand	431-453	23	5
β-strand	456-473	18	5
β-strand	478-495	18	5
β-strand	501-512	12	5
β-strand	517	1	8
β-strand	523	1	8
α-helix	524-526	3
β-strand	527-538	12	5
β-strand	545-562	18	5
β-strand	570-588	19	5
β-strand	593-608	16	5
α-helix	615-617	3
β-strand	623-633	11	5
β-strand	641-650	10	5
β-strand	653-654	2	9
β-strand	662-663	2	9
α-helix	664-665	2
β-strand	666-676	11	5
α-helix	677-680	4
β-strand	686-692	7	5
β-strand	700-705	6	6
β-strand	708-711	4	6
α-helix	712-714	3
β-strand	716-724	9	5

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	10
β-strand	19	1	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferrichrome-iron receptor	A	protein	706	ESCHERICHIA COLI STR. K-12 SUBSTR. MG1655	P06971 (AlphaFold model)
Microcin J25	B	protein	21	ESCHERICHIA COLI STR. K-12 SUBSTR. MC4100	Q9X2V7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4CU4_1 FERRICHROME-IRON RECEPTOR (chains A)
SAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSVG
TRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAEIMRGPVSVL
YGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDSLDDDGVYSYRLTGLAR
SANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLPKEGTVEPLPNG
KRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCS
DPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGVD
FMRMRNDINAWFGYDDSVPLLNLYNPSSHHHHHHGSSVNTDFDFNAKDPANSGPYRILNK
QKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNYLFDN
GVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTNN
LMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPAQ
VPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDALVRYDLAR
VGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF

Sequence of entity 2 (B), FASTA

>4CU4_2 MICROCIN J25 (chains B)
GGAGHVPEYFVGIGTPISFYG

Ligands and cofactors

ID	Name	Formula	Copies
FTT	3-hydroxy-tetradecanoic acid	C14 H28 O3	4
DAO	Lauric acid	C12 H24 O2	1
MYR	Myristic acid	C14 H28 O2	1
LDA	Lauryl dimethylamine-N-oxide	C14 H31 N O	20
3PH	1,2-diacyl-glycerol-3-sn-phosphate	C39 H77 O8 P	1
DPO	Diphosphate	O7 P2	2
PO4	Phosphate ion	O4 P	2

Primary citation

Structural Basis for Hijacking Siderophore Receptors by Antimicrobial Lasso Peptides. Mathavan, I., Zirah, S., Mehmood, S. et al. Nat Chem Biol (2014) 10:340. DOI 10.1038/NCHEMBIO.1499 · PubMed

Other PDB entries of the same protein (UniProt P06971 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QFG 2.5 Å, E. Coli ferric hydroxamate receptor (FHUA)
2FCP 2.5 Å, Ferric hydroxamate uptake receptor (FHUA) from e.coli
1BY5 2.6 Å, Fhua from E. Coli, with its ligand ferrichrome
8B14 2.6 Å, T5 Receptor Binding Protein pb5 in complex with its E. coli receptor FhuA
1FCP 2.7 Å, Ferric hydroxamate uptake receptor (FHUA) from e.coli in complex with bound…
1QFF 2.7 Å, E. Coli ferric hydroxamate uptake receptor (FHUA) in complex with bound ferrichrome-iron
1BY3 2.74 Å, Fhua from E. Coli
1FI1 2.9 Å, FhuA in complex with lipopolysaccharide and rifamycin CGP4832
1QJQ 2.95 Å, Ferric hydroxamate receptor from escherichia coli (FHUA)
1QKC 3.1 Å, Escherichia coli ferric hydroxamate uptake receptor (FHUA) in complex delta two-albomycin
8A8C 3.1 Å, T5 phage receptor-binding protein pb5 bound to ferrichrome transporter FhuA
2GRX 3.3 Å, Crystal structure of TonB in complex with FhuA, E. coli outer membrane receptor for…

Browse structure collections

About this viewer

MolViewer shows 4CU4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.