1CDZ: Brct domain from DNA-repair protein XRCC1

Brct domain from DNA-repair protein XRCC1. Determined by X-ray diffraction at 3.2 Å resolution. Released 28 Feb 2000.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 808
Mol. weight: 11.42 kDa
Released: 28 Feb 2000

Explore 1CDZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CDZ contains 4 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	1
α-helix	20-31	12
β-strand	35-36	2	1
β-strand	46-48	3	1
α-helix	55-61	7
β-strand	68-70	3	1
α-helix	73-79	7
α-helix	87-90	4
β-strand	91	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (DNA-repair protein XRCC1)	A	protein	96	Homo sapiens	P18887 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CDZ_1 PROTEIN (DNA-REPAIR PROTEIN XRCC1) (chains A)
ELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEA
LMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA

Primary citation

Structure of an XRCC1 BRCT domain: a new protein-protein interaction module. Zhang, X., Morera, S., Bates, P.A. et al. EMBO J (1998) 17:6404-6411. DOI 10.1093/emboj/17.21.6404 · PubMed

Other PDB entries of the same protein (UniProt P18887 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W3O 1.85 Å, Crystal structure of the human PNKP FHA domain in complex with an XRCC1-derived…
5W7X 2.0 Å, Crystal Structure of FHA domain of human APLF in complex with XRCC1 bisphospho peptide
5W7Y 2.1 Å, Crystal Structure of FHA domain of human APLF in complex with XRCC1 monophosphorylated…
5E6Q 2.31 Å, Importin alpha binding to XRCC1 NLS peptide
3LQC 2.35 Å, X-ray crystal structure of oxidized XRCC1 bound to DNA pol beta Palm thumb domain
6WH1 2.4 Å, Structure of the complex of human DNA ligase III-alpha and XRCC1 BRCT domains
6WH2 2.41 Å, Structure of the C-terminal BRCT domain of human XRCC1
3K77 2.6 Å, X-ray crystal structure of XRCC1
3K75 2.95 Å, X-ray crystal structure of reduced XRCC1 bound to DNA pol beta catalytic domain
1XNA NMR solution structure of the single-strand break repair protein XRCC1-N-terminal domain
1XNT NMR solution structure of the single-strand break repair protein XRCC1-N-terminal domain
2D8M Solution structure of the first BRCT domain of DNA-repair protein XRCC1

Browse structure collections

About this viewer

MolViewer shows 1CDZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.