2D8M: First BRCT domain of DNA-repair protein XRCC1

Solution structure of the first BRCT domain of DNA-repair protein XRCC1. Determined by solution NMR. Released 6 Jun 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 985
Mol. weight: 14.05 kDa
Released: 6 Jun 2006

Explore 2D8M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2D8M contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
α-helix	16-19	4
β-strand	26-31	6	1
α-helix	37-47	11
β-strand	50-53	4	1
β-strand	62-65	4	1
α-helix	71-79	9
β-strand	82-85	4	1
α-helix	87-94	8
α-helix	101-104	4
β-strand	105	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-repair protein XRCC1	A	protein	129	Homo sapiens	P18887 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2D8M_1 DNA-repair protein XRCC1 (chains A)
GSSGSSGEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDS
THLICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSQRYLMAGPGSSSEEDEASH
SGGSGPSSG

Primary citation

Solution structure of the first BRCT domain of DNA-repair protein XRCC1. Nagashima, T., Hayashi, F., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt P18887 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W3O 1.85 Å, Crystal structure of the human PNKP FHA domain in complex with an XRCC1-derived…
5W7X 2.0 Å, Crystal Structure of FHA domain of human APLF in complex with XRCC1 bisphospho peptide
5W7Y 2.1 Å, Crystal Structure of FHA domain of human APLF in complex with XRCC1 monophosphorylated…
5E6Q 2.31 Å, Importin alpha binding to XRCC1 NLS peptide
3LQC 2.35 Å, X-ray crystal structure of oxidized XRCC1 bound to DNA pol beta Palm thumb domain
6WH1 2.4 Å, Structure of the complex of human DNA ligase III-alpha and XRCC1 BRCT domains
6WH2 2.41 Å, Structure of the C-terminal BRCT domain of human XRCC1
3K77 2.6 Å, X-ray crystal structure of XRCC1
3K75 2.95 Å, X-ray crystal structure of reduced XRCC1 bound to DNA pol beta catalytic domain
1CDZ 3.2 Å, Brct domain from DNA-repair protein XRCC1
1XNA NMR solution structure of the single-strand break repair protein XRCC1-N-terminal domain
1XNT NMR solution structure of the single-strand break repair protein XRCC1-N-terminal domain

Browse structure collections

About this viewer

MolViewer shows 2D8M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.