NMR solution structure of the single-strand break repair protein XRCC1-N-terminal domain. Determined by solution NMR. Released 1 Sept 1999.
Explore 1XNT in 3D Show helices and sheets RCSB PDB PDBe
1XNT contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6 | 1 | 1 |
| β-strand | 11-13 | 3 | 2 |
| α-helix | 21-26 | 6 | |
| β-strand | 42-53 | 12 | 2 |
| β-strand | 57-64 | 8 | 3 |
| β-strand | 67-73 | 7 | 2 |
| β-strand | 85-92 | 8 | 2 |
| α-helix | 98-101 | 4 | |
| β-strand | 107-111 | 5 | 3 |
| α-helix | 118-121 | 4 | |
| β-strand | 125-133 | 9 | 2 |
| β-strand | 143-150 | 8 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (DNA-repair protein XRCC1) | A | protein | 183 | Homo sapiens | P18887 (AlphaFold model) |
>1XNT_1 PROTEIN (DNA-REPAIR PROTEIN XRCC1) (chains A) MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI GNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAA AEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEEE SAN
Solution structure of the single-strand break repair protein XRCC1 N-terminal domain. Marintchev, A., Mullen, M.A., Maciejewski, M.W. et al. Nat Struct Biol (1999) 6:884-893. DOI 10.1038/12347 · PubMed
Other PDB entries of the same protein (UniProt P18887 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1XNT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.