6WH2: C-terminal BRCT domain of human XRCC1

Structure of the C-terminal BRCT domain of human XRCC1. Determined by X-ray diffraction at 2.41 Å resolution. Released 2 Dec 2020.

Method: X-ray diffraction
Resolution: 2.41 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,665
Mol. weight: 22.84 kDa
Released: 2 Dec 2020

Explore 6WH2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WH2 contains 9 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	547-551	5	1
α-helix	558-568	11
β-strand	572-573	2	1
β-strand	583-586	4	1
α-helix	592-600	9
β-strand	605-607	3	1
α-helix	609-618	10
α-helix	624-627	4
β-strand	628	1	1

Chain B: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	547-550	4	2
α-helix	558-568	11
β-strand	572-573	2	2
β-strand	583-585	3	2
α-helix	589-591	3
α-helix	592-600	9
β-strand	605-607	3	2
α-helix	610-618	9
α-helix	624-627	4
β-strand	628	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
X-ray repair cross complementing protein 1 variant	A, B	protein	96	Homo sapiens	P18887 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6WH2_1 X-ray repair cross complementing protein 1 variant (chains A, B)
ELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEA
LMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA

Primary citation

An atypical BRCT-BRCT interaction with the XRCC1 scaffold protein compacts human DNA Ligase III alpha within a flexible DNA repair complex. Hammel, M., Rashid, I., Sverzhinsky, A. et al. Nucleic Acids Res (2021) 49:306-321. DOI 10.1093/nar/gkaa1188 · PubMed

Other PDB entries of the same protein (UniProt P18887 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W3O 1.85 Å, Crystal structure of the human PNKP FHA domain in complex with an XRCC1-derived…
5W7X 2.0 Å, Crystal Structure of FHA domain of human APLF in complex with XRCC1 bisphospho peptide
5W7Y 2.1 Å, Crystal Structure of FHA domain of human APLF in complex with XRCC1 monophosphorylated…
5E6Q 2.31 Å, Importin alpha binding to XRCC1 NLS peptide
3LQC 2.35 Å, X-ray crystal structure of oxidized XRCC1 bound to DNA pol beta Palm thumb domain
6WH1 2.4 Å, Structure of the complex of human DNA ligase III-alpha and XRCC1 BRCT domains
3K77 2.6 Å, X-ray crystal structure of XRCC1
3K75 2.95 Å, X-ray crystal structure of reduced XRCC1 bound to DNA pol beta catalytic domain
1CDZ 3.2 Å, Brct domain from DNA-repair protein XRCC1
1XNA NMR solution structure of the single-strand break repair protein XRCC1-N-terminal domain
1XNT NMR solution structure of the single-strand break repair protein XRCC1-N-terminal domain
2D8M Solution structure of the first BRCT domain of DNA-repair protein XRCC1

Browse structure collections

About this viewer

MolViewer shows 6WH2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.