1CMI: Human PIN/LC8 dimer with a bound peptide

Structure of the human PIN/LC8 dimer with a bound peptide. Determined by X-ray diffraction at 2.5 Å resolution. Released 21 Feb 2000.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 1,596
Mol. weight: 22.74 kDa
Released: 21 Feb 2000

Explore 1CMI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CMI contains 4 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
α-helix	15-31	17
β-strand	32	1	2
α-helix	35-50	16
β-strand	54-59	6	1
β-strand	61-69	9	3
β-strand	73-78	6	1
β-strand	81-87	7	1

Chain B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	4
α-helix	17-31	15
β-strand	32	1	2
α-helix	35-50	16
β-strand	54-59	6	4
β-strand	61-69	9	5
β-strand	73-78	6	4
β-strand	81-87	7	4

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	4-12	9	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynein light chain 1, cytoplasmic	A, B	protein	85	Homo sapiens	P63167 (AlphaFold model)
Nitric oxide synthase 1	C, D	protein	13	Mus musculus	P29476 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1CMI_1 Dynein light chain 1, cytoplasmic (chains A, B)
KAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGS
YVTHETKHFIYFYLGQVAILLFKSG

Sequence of entity 2 (C, D), FASTA

>1CMI_2 Nitric oxide synthase 1 (chains C, D)
KAEMKDTGIQVDR

Primary citation

Structure of the PIN/LC8 dimer with a bound peptide. Liang, J., Jaffrey, S.R., Guo, W. et al. Nat Struct Biol (1999) 6:735-740. DOI 10.1038/11501 · PubMed

Other PDB entries of the same protein (UniProt P63167 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9NZ7 1.41 Å, Crystal structure of human DYNLL1-S64A/S88A mutant dimer
6GZL 1.95 Å, Complex between the dynein light chain DYNLL1/DLC8 and a peptide from the large…
6GZJ 1.98 Å, Complex between the dynein light chain DYNLL1/DLC8 and the specific domain of large…
3ZKE 2.2 Å, Structure of LC8 in complex with Nek9 peptide
7D35 2.4 Å, Human LC8 bound to ebola virus VP35(67-76)
3ZKF 2.6 Å, Structure of LC8 in complex with Nek9 phosphopeptide
9BLY 3.5 Å, Composite structure of full-length human dynein-1 in phi-particle conformation
6SC2 3.9 Å, Structure of the dynein-2 complex; IFT-train bound model
8RGG 4.0 Å, Structure of dynein-2 intermediate chain DYNC2I2 (WDR34) in complex with dynein-2 heavy…
9E28 4.4 Å, Cryo-EM structure of Phi dynein tail
6RLB 4.5 Å, Structure of the dynein-2 complex; tail domain
9E12 4.5 Å, Full-length human dynein-1 in phi comformation under Lis1 condition

Browse structure collections

About this viewer

MolViewer shows 1CMI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.