1CY5: Apaf-1 card

Crystal structure of the apaf-1 card. Determined by X-ray diffraction at 1.3 Å resolution. Released 13 Sept 1999.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 861
Mol. weight: 11.5 kDa
Ligands: ZN
Released: 13 Sept 1999

Explore 1CY5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CY5 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	3-11	9
α-helix	13-19	7
α-helix	22-32	11
α-helix	37-44	8
α-helix	49-61	13
α-helix	65-77	13
α-helix	81-87	7
α-helix	88-90	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (apoptotic protease activating factor 1)	A	protein	97	Homo sapiens	O14727 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CY5_1 PROTEIN (APOPTOTIC PROTEASE ACTIVATING FACTOR 1) (chains A)
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	5

Water and common crystallization additives (BME) are not listed.

Primary citation

Crystal structure of Apaf-1 caspase recruitment domain: an alpha-helical Greek key fold for apoptotic signaling. Vaughn, D.E., Rodriguez, J., Lazebnik, Y. et al. J Mol Biol (1999) 293:439-447. DOI 10.1006/jmbi.1999.3177 · PubMed

Other PDB entries of the same protein (UniProt O14727 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2P1H 1.59 Å, Rapid Folding and Unfolding of Apaf-1 CARD
2YGS 1.6 Å, Card domain from apaf-1
4RHW 2.1 Å, Crystal structure of Apaf-1 CARD and caspase-9 CARD complex
1Z6T 2.21 Å, Structure of the apoptotic protease-activating factor 1 bound to ADP
3YGS 2.5 Å, Apaf-1 card in complex with prodomain of procaspase-9
8XQK 2.85 Å, The Crystal Structure of Apaf from Biortus.
5WVC 2.99 Å, Structure of the CARD-CARD disk
3JBT 3.8 Å, Atomic structure of the Apaf-1 apoptosome
5JUY 4.1 Å, Active human apoptosome with procaspase-9
5WVE 4.4 Å, Apaf-1-Caspase-9 holoenzyme
3J2T 9.5 Å, An improved model of the human apoptosome
1C15 Solution structure of apaf-1 card

Browse structure collections

About this viewer

MolViewer shows 1CY5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.