Heat-labile enterotoxin B-pentamer complexed with para-aminophenyl-alpha-D-galactopyranoside. Determined by X-ray diffraction at 1.6 Å resolution. Released 23 Feb 2000.
Explore 1EFI in 3D Show helices and sheets RCSB PDB PDBe
1EFI contains 21 α-helices and 30 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 61-78 | 18 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-61 | 3 | |
| α-helix | 62-77 | 16 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-10 | 6 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 61-78 | 18 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (heat-labile enterotoxin B chain) | D, E, F, G, H | protein | 103 | Escherichia coli | P32890 (AlphaFold model) |
>1EFI_1 PROTEIN (HEAT-LABILE ENTEROTOXIN B CHAIN) (chains D, E, F, G, H) APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDS QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
| ID | Name | Formula | Copies |
|---|---|---|---|
| GAT | 4-aminophenyl alpha-D-galactopyranoside | C12 H17 N O6 | 5 |
Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives. Fan, E., Merritt, E.A., Zhang, Z. et al. Acta Crystallogr D Biol Crystallogr (2001) 57:201-212. DOI 10.1107/S0907444900016814 · PubMed
Other PDB entries of the same protein (UniProt P32890 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1EFI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.