1EM7: Protein G

Helix variant of the B1 domain from streptococcal protein G. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 May 2002.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Streptococcus sp.
Chains: 1
Atoms: 472
Mol. weight: 6.29 kDa
Released: 8 May 2002

Explore 1EM7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EM7 contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	14-19	6	1
α-helix	23-36	14
β-strand	42-46	5	1
β-strand	51-55	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein G	A	protein	56	Streptococcus sp.	P06654 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EM7_1 PROTEIN G (chains A)
TTYKLILNGKTLKGETTTEAVDAETAERVFKEYAKKNGVDGEWTYDDATKTFTVTE

Primary citation

Structure of a protein G helix variant suggests the importance of helix propensity and helix dipole interactions in protein design. Strop, P., Marinescu, A.M., Mayo, S.L. Protein Sci (2000) 9:1391-1394. PubMed

Other PDB entries of the same protein (UniProt P06654 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IGD 1.1 Å, The third IgG-binding domain from streptococcal protein G: an analysis by X-ray…
2IGD 1.1 Å, Anisotropic structure of protein G IgG-binding domain III at 1.1 Å resolution
3MP9 1.2 Å, Structure of Streptococcal protein G B1 domain at pH 3.0
6CNE 1.2 Å, Selenomethionine variant (V29SeM) of protein GB1
1PGX 1.66 Å, The 1.66 Å X-ray structure of the B2 immunoglobulin-binding domain of streptococcal…
6L9D 1.73 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11S
6L91 1.84 Å, X-ray structure of synthetic GB1 domain with the mutation K10(DVA).
6LJI 1.84 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11V
1PGB 1.92 Å, Two crystal structures of the B1 immunoglobulin-binding domain of streptoccocal protein…
4KGS 1.95 Å, Backbone Modifications in the Protein GB1 Loops: beta-3-Val21, beta-3-Asp40
6L9B 1.95 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11A
4KGR 2.0 Å, Backbone Modifications in the Protein GB1 Helix: beta-3-Ala24, beta-3-Lys28,…

Browse structure collections

About this viewer

MolViewer shows 1EM7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.