1F81: Creb-binding protein

Name: PDB 1F81: Solution structure of the TAZ2 domain of the transcriptional adaptor protein cbp
Published: 2000-10-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Solution structure of the TAZ2 domain of the transcriptional adaptor protein cbp. Determined by solution NMR. Released 18 Oct 2000.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 680
Mol. weight: 10.2 kDa
Ligands: ZN
Released: 18 Oct 2000

Explore 1F81 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F81 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	2-22	21
α-helix	31-45	15
α-helix	49-53	5
α-helix	55-70	16
α-helix	81-86	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Creb-binding protein	A	protein	88	Mus musculus	P45481 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1F81_1 CREB-BINDING PROTEIN (chains A)
MSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQ
LIALCCYHAKHCQENKCPVPFCLNIKHK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Solution structure of the TAZ2 (CH3) domain of the transcriptional adaptor protein CBP. De Guzman, R.N., Liu, H.Y., Martinez-Yamout, M. et al. J Mol Biol (2000) 303:243-253. DOI 10.1006/jmbi.2000.4141 · PubMed

Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0I 1.43 Å, CREBBP Bromodomain in complex with Cpd8 (1-(3-(7-(difluoromethyl)-6-(1-methyl-1H-pyrazol-…
8CNB 1.99 Å, Crystal structure of CREBBP-Y1503C histone acetyltransferase domain in complex with…
4I9O 2.0 Å, Crystal Structure of GACKIX L664C Tethered to 1-10
7LVS 2.02 Å, The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide
8CMZ 2.25 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with…
6DNQ 2.35 Å, HBZ77 in complex with KIX and c-Myb
5U7G 2.4 Å, Crystal Structure of the Catalytic Core of CBP
8CN0 2.44 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with…
8CNA 2.46 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with a…
8OG2 2.47 Å, Crystal structure of CREBBP histone acetyltransferase domain in complex with Coenzyme A
6DMX 2.8 Å, HBZ56 in complex with KIX and c-Myb
8CND 2.97 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with a…

Browse structure collections

About this viewer

MolViewer shows 1F81 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.