Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with Coenzyme A. Determined by X-ray diffraction at 2.44 Å resolution. Released 6 Mar 2024.
Explore 8CN0 in 3D Show helices and sheets RCSB PDB PDBe
8CN0 contains 32 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1087-1102 | 16 | |
| α-helix | 1109-1111 | 3 | |
| α-helix | 1117-1120 | 4 | |
| α-helix | 1125-1128 | 4 | |
| α-helix | 1135-1144 | 10 | |
| α-helix | 1150-1167 | 18 | |
| α-helix | 1173-1195 | 23 | |
| β-strand | 1205 | 1 | 1 |
| α-helix | 1206-1208 | 3 | |
| α-helix | 1276 | 1 | |
| β-strand | 1277 | 1 | 1 |
| α-helix | 1278-1279 | 2 | |
| β-strand | 1280-1282 | 3 | 2 |
| β-strand | 1289-1291 | 3 | 2 |
| α-helix | 1292-1295 | 4 | |
| α-helix | 1309-1315 | 7 | |
| α-helix | 1319-1321 | 3 | |
| α-helix | 1330-1331 | 2 | |
| α-helix | 1333-1348 | 16 | |
| β-strand | 1357-1370 | 14 | 3 |
| α-helix | 1371-1372 | 2 | |
| α-helix | 1373-1375 | 3 | |
| α-helix | 1376-1380 | 5 | |
| β-strand | 1388-1402 | 15 | 3 |
| β-strand | 1405-1417 | 13 | 3 |
| α-helix | 1422 | 1 | |
| β-strand | 1428-1436 | 9 | 3 |
| α-helix | 1443-1464 | 22 | |
| β-strand | 1468-1472 | 5 | 3 |
| α-helix | 1475-1477 | 3 | |
| α-helix | 1496-1512 | 17 | |
| β-strand | 1518-1521 | 4 | 3 |
| α-helix | 1522-1528 | 7 | |
| α-helix | 1534-1536 | 3 | |
| α-helix | 1544-1554 | 11 | |
| α-helix | 1621-1627 | 7 | |
| α-helix | 1629-1631 | 3 | |
| β-strand | 1632-1636 | 5 | 3 |
| α-helix | 1647-1649 | 3 | |
| α-helix | 1654-1655 | 2 | |
| α-helix | 1659-1661 | 3 | |
| α-helix | 1665-1674 | 10 | |
| α-helix | 1681-1698 | 18 | |
| β-strand | 1706 | 1 | 4 |
| β-strand | 1713 | 1 | 4 |
| β-strand | 1717-1720 | 4 | 5 |
| β-strand | 1727-1728 | 2 | 5 |
| β-strand | 1742-1745 | 4 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| histone acetyltransferase | A | protein | 640 | Mus musculus | P45481 (AlphaFold model) |
>8CN0_1 histone acetyltransferase (chains A) HHHHHHDYDIPTTENLYFQGAMGSSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQ PVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSR VYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNR YHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQI CVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPE AGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMH VQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWA CPPSEGDDNIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTS AKELPYFEGDFWPNVLEESIKESGGSGSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIV DPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNEC KHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD
Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with Coenzyme A. Mechaly, A.E., Zhang, W., Haouz, A. et al. To be published.
Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8CN0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.