Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with a bisubstrate inhibitor, Lys-CoA. Determined by X-ray diffraction at 2.46 Å resolution. Released 6 Mar 2024.
Explore 8CNA in 3D Show helices and sheets RCSB PDB PDBe
8CNA contains 32 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1087-1103 | 17 | |
| α-helix | 1109-1111 | 3 | |
| α-helix | 1117-1120 | 4 | |
| α-helix | 1125-1128 | 4 | |
| α-helix | 1135-1143 | 9 | |
| α-helix | 1150-1167 | 18 | |
| α-helix | 1173-1195 | 23 | |
| β-strand | 1205 | 1 | 1 |
| α-helix | 1206-1208 | 3 | |
| α-helix | 1276 | 1 | |
| β-strand | 1277 | 1 | 1 |
| α-helix | 1278-1279 | 2 | |
| β-strand | 1280-1282 | 3 | 2 |
| β-strand | 1289-1291 | 3 | 2 |
| α-helix | 1292-1295 | 4 | |
| α-helix | 1310-1313 | 4 | |
| α-helix | 1317-1321 | 5 | |
| α-helix | 1330-1331 | 2 | |
| α-helix | 1333-1348 | 16 | |
| β-strand | 1357-1370 | 14 | 3 |
| α-helix | 1371-1372 | 2 | |
| α-helix | 1373-1377 | 5 | |
| β-strand | 1388-1402 | 15 | 3 |
| β-strand | 1405-1417 | 13 | 3 |
| α-helix | 1422 | 1 | |
| β-strand | 1428-1436 | 9 | 3 |
| α-helix | 1443-1445 | 3 | |
| α-helix | 1446-1464 | 19 | |
| β-strand | 1468-1469 | 2 | 3 |
| β-strand | 1472 | 1 | 4 |
| α-helix | 1475-1477 | 3 | |
| α-helix | 1492-1495 | 4 | |
| α-helix | 1496-1512 | 17 | |
| β-strand | 1518-1521 | 4 | 3 |
| α-helix | 1522-1526 | 5 | |
| α-helix | 1534-1536 | 3 | |
| α-helix | 1544-1551 | 8 | |
| α-helix | 1621-1624 | 4 | |
| β-strand | 1632 | 1 | 4 |
| β-strand | 1633-1636 | 4 | 3 |
| α-helix | 1647-1649 | 3 | |
| α-helix | 1654-1655 | 2 | |
| β-strand | 1656 | 1 | 3 |
| α-helix | 1659-1661 | 3 | |
| α-helix | 1665-1674 | 10 | |
| α-helix | 1681-1697 | 17 | |
| β-strand | 1719-1720 | 2 | 5 |
| β-strand | 1742-1743 | 2 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| histone acetyltransferase | A | protein | 640 | Mus musculus | P45481 (AlphaFold model) |
>8CNA_1 histone acetyltransferase (chains A) HHHHHHDYDIPTTENLYFQGAMGSSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQ PVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSR VYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNR YHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQI CVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPE AGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMH VQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLCTAVYHEILIGYLEYVKKLGYVTGHIWA CPPSEGDDYIFHCHPPDQKIPKPKRLQEWFKKMLDKAFAERIINDYKDIFKQANEDRLTS AKELPYFEGDFWPNVLEESIKESGGSGSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIV DPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNEC KHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
| 01K | [(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofu… | C31 H53 N10 O19 P3 S | 1 |
Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with a bisubstrate inhibitor, Lys-CoA. Mechaly, A.E., Zhang, W., Haouz, A. et al. To be published.
Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8CNA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.