4I9O: GACKIX L664C Tethered to 1-10

Crystal Structure of GACKIX L664C Tethered to 1-10. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Mar 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Mus musculus
Chains: 1
Atoms: 694
Mol. weight: 12.63 kDa
Ligands: KI1
Released: 6 Mar 2013

Explore 4I9O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4I9O contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	590-594	5
α-helix	597-611	15
α-helix	622-642	21
α-helix	646-664	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CREB-binding protein	A	protein	101	Mus musculus	P45481 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4I9O_1 CREB-binding protein (chains A)
MRGSHHHHHHGMASGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAY
AKKVEGDMYESANSRDEYYHLLAEKIYKIQKECEEKRRSRL

Ligands and cofactors

ID	Name	Formula	Copies
KI1	1-{4-[4-chloro-3-(trifluoromethyl)phenyl]-4-hydroxypiperidin-1-yl}-3-sulfanylpr…	C15 H17 Cl F3 N O2 S	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Ordering a dynamic protein via a small-molecule stabilizer. Wang, N., Majmudar, C.Y., Pomerantz, W.C. et al. J Am Chem Soc (2013) 135:3363-3366. DOI 10.1021/ja3122334 · PubMed

Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0I 1.43 Å, CREBBP Bromodomain in complex with Cpd8 (1-(3-(7-(difluoromethyl)-6-(1-methyl-1H-pyrazol-…
8CNB 1.99 Å, Crystal structure of CREBBP-Y1503C histone acetyltransferase domain in complex with…
7LVS 2.02 Å, The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide
8CMZ 2.25 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with…
6DNQ 2.35 Å, HBZ77 in complex with KIX and c-Myb
5U7G 2.4 Å, Crystal Structure of the Catalytic Core of CBP
8CN0 2.44 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with…
8CNA 2.46 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with a…
8OG2 2.47 Å, Crystal structure of CREBBP histone acetyltransferase domain in complex with Coenzyme A
6DMX 2.8 Å, HBZ56 in complex with KIX and c-Myb
8CND 2.97 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with a…
1F81 Solution structure of the TAZ2 domain of the transcriptional adaptor protein cbp

Browse structure collections

About this viewer

MolViewer shows 4I9O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.