Solution structure of the TAZ2 domain of the transcriptional adaptor protein cbp. Determined by solution NMR. Released 18 Oct 2000.
Explore 1F81 in 3D Show helices and sheets RCSB PDB PDBe
1F81 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-22 | 21 | |
| α-helix | 31-45 | 15 | |
| α-helix | 49-53 | 5 | |
| α-helix | 55-70 | 16 | |
| α-helix | 81-86 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Creb-binding protein | A | protein | 88 | Mus musculus | P45481 (AlphaFold model) |
>1F81_1 CREB-BINDING PROTEIN (chains A) MSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQ LIALCCYHAKHCQENKCPVPFCLNIKHK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Solution structure of the TAZ2 (CH3) domain of the transcriptional adaptor protein CBP. De Guzman, R.N., Liu, H.Y., Martinez-Yamout, M. et al. J Mol Biol (2000) 303:243-253. DOI 10.1006/jmbi.2000.4141 · PubMed
Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1F81 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.