1FC2: Fragment B of protein A complex

Crystallographic Refinement and Atomic Models of a Human FC Fragment and its Complex with Fragment B of Protein A from Staphylococcus Aureus at 2.9-and 2.8-Angstroms Resolution. Determined by X-ray diffraction at 2.8 Å resolution. Released 2 Oct 1981.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Staphylococcus aureus subsp. aureus, Homo sapiens
Chains: 2
Atoms: 2,125
Mol. weight: 33.57 kDa
Released: 2 Oct 1981

Explore 1FC2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FC2 contains 9 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	128-136	9
α-helix	144-155	12

Chain D: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	240-243	4	1
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-265	8	1
β-strand	275-279	5	2
β-strand	282-283	2	2
β-strand	292-295	4	1
β-strand	300-307	8	1
α-helix	310-314	5
β-strand	319-323	5	2
β-strand	332-336	5	2
β-strand	344	1	3
β-strand	347-351	5	4
α-helix	352-354	3
α-helix	355-357	3
β-strand	362-372	11	4
β-strand	373	1	3
β-strand	377-383	7	5
β-strand	386-387	2	5
β-strand	391-393	3	4
α-helix	394-396	3
β-strand	397-398	2	4
β-strand	404-413	10	4
α-helix	414-418	5
β-strand	423-429	7	5
β-strand	437-441	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fragment B of protein A complex	C	protein	58	Staphylococcus aureus subsp. aureus	P38507 (AlphaFold model)
Immunoglobulin fc	D	protein	224	Homo sapiens	P01857 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1FC2_1 FRAGMENT B OF PROTEIN A COMPLEX (chains C)
ADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQXXK

Sequence of entity 2 (D), FASTA

>1FC2_2 IMMUNOGLOBULIN FC (chains D)
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGV
QVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQ
PREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

Primary citation

Crystallographic refinement and atomic models of a human Fc fragment and its complex with fragment B of protein A from Staphylococcus aureus at 2.9- and 2.8-A resolution. Deisenhofer, J. Biochemistry (1981) 20:2361-2370. DOI 10.1021/bi00512a001 · PubMed

Other PDB entries of the same protein (UniProt P38507 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NPD 0.9 Å, High-resolution structure of C domain of staphylococcal protein A at cryogenic temperature
4NPE 1.42 Å, High-resolution structure of C domain of staphylococcal protein A at room temperature
4NPF 1.49 Å, High-resolution structure of two tandem B domains of staphylococcal protein A connected…
8CPL 1.6 Å, YZw2 a scaffold for cryo-EM of small proteins of interest
4ZMD 1.87 Å, C domain of staphylococcal protein A mutant - Q9W
4ZNC 2.28 Å, Fc fragment of human IgG in complex with the C domain of staphylococcal protein A mutant…
1LP1 2.3 Å, Protein Z in complex with an in vitro selected affibody
5CBN 2.3 Å, Fusion protein of mbp3-16 and B4 domain of protein A from staphylococcal aureus with…
4WWI 2.31 Å, Crystal structure of the C domain of staphylococcal protein A in complex with the Fc…
5H7D 2.57 Å, Crystal structure of the YgjG-protein A-Zpa963-calmodulin complex
5EWX 2.6 Å, Fusion protein of T4 lysozyme and B4 domain of protein A from staphylococcal aureus with…
5H76 2.6 Å, Crystal structure of the DARPin-Protein A fusion protein

Browse more

1FC2 is part of these collections:

Antibodies and the immune system

About this viewer

MolViewer shows 1FC2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.