Murine T-cell antigen receptor 2C clone. Determined by X-ray diffraction at 2.5 Å resolution. Released 12 Mar 1997.
Explore 1TCR in 3D Show helices and sheets RCSB PDB PDBe
1TCR contains 9 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-4 | 2 | 1 |
| β-strand | 9-13 | 5 | 2 |
| β-strand | 18-20 | 3 | 1 |
| β-strand | 23-24 | 2 | 1 |
| β-strand | 31-37 | 7 | 2 |
| β-strand | 44-49 | 6 | 2 |
| β-strand | 55-57 | 3 | 1 |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 72-77 | 6 | 1 |
| α-helix | 82-84 | 3 | |
| β-strand | 86-99 | 9 | 2 |
| β-strand | 102-106 | 5 | 2 |
| β-strand | 110-115 | 6 | 2 |
| β-strand | 124-129 | 6 | 3 |
| β-strand | 139-144 | 6 | 3 |
| α-helix | 151-155 | 5 | |
| β-strand | 160-162 | 3 | 3 |
| β-strand | 166-169 | 4 | 3 |
| β-strand | 176-184 | 9 | 3 |
| α-helix | 191-194 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 4 |
| β-strand | 10-14 | 5 | 5 |
| β-strand | 19-21 | 3 | 6 |
| β-strand | 22-25 | 4 | 4 |
| β-strand | 31-38 | 8 | 5 |
| β-strand | 42-49 | 8 | 5 |
| β-strand | 56-57 | 2 | 5 |
| β-strand | 66-68 | 3 | 6 |
| β-strand | 74 | 1 | 4 |
| β-strand | 76-79 | 4 | 6 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 5 |
| β-strand | 106-108 | 3 | 5 |
| β-strand | 112-116A | 6 | 5 |
| α-helix | 119-121 | 3 | |
| β-strand | 126-130 | 5 | 7 |
| β-strand | 131 | 1 | 3 |
| α-helix | 132-133 | 2 | |
| α-helix | 134-140 | 7 | |
| β-strand | 142-152 | 11 | 7 |
| β-strand | 157-163 | 7 | 8 |
| β-strand | 166-167 | 2 | 8 |
| β-strand | 172-174 | 3 | 7 |
| α-helix | 178 | 1 | |
| β-strand | 179-182 | 4 | 7 |
| β-strand | 189-199 | 11 | 7 |
| α-helix | 200-203 | 4 | |
| β-strand | 209-216 | 8 | 8 |
| β-strand | 219 | 1 | 9 |
| β-strand | 233 | 1 | 9 |
| β-strand | 235-242 | 8 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alpha, beta T-cell receptor (VB8.2DB2JB2.4CB2\;VA3JA58CA) | A | protein | 202 | Mus musculus | P01738 (AlphaFold model) |
| Alpha, beta T-cell receptor (VB8.2DB2JB2.4CB2\;VA3JA58CA) | B | protein | 237 | Mus musculus |
>1TCR_1 ALPHA, BETA T-CELL RECEPTOR (VB8.2DB2JB2.4CB2\;VA3JA58CA) (chains A) QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVN GFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAV YALKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDATVLDMKAMDSKSNGAIAWSNQT SFTCQDIFKETNATYPSSDVPC
>1TCR_2 ALPHA, BETA T-CELL RECEPTOR (VB8.2DB2JB2.4CB2\;VA3JA58CA) (chains B) EAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDI PDGYKASRPSQENFSLILELATPSQTSVYFCASGGGGTLYFGAGTRLSVLEDLRNVTPPK VSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSY CLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADC
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Water and common crystallization additives (SO4) are not listed.
An alphabeta T cell receptor structure at 2.5 A and its orientation in the TCR-MHC complex. Garcia, K.C., Degano, M., Stanfield, R.L. et al. Science (1996) 274:209-219. DOI 10.1126/science.274.5285.209 · PubMed
Other PDB entries of the same protein (UniProt P01738 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1TCR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.