2CKB: 2C/KB/DEV8 complex

Structure of the 2C/KB/DEV8 complex. Determined by X-ray diffraction at 3.0 Å resolution. Released 29 Apr 1998.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Mus musculus
Chains: 10
Atoms: 13,110
Mol. weight: 186 kDa
Released: 29 Apr 1998

Explore 2CKB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CKB contains 38 α-helices and 145 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 3 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	9-13	5	2
β-strand	18-20	3	3
β-strand	23-25	3	1
β-strand	32-37	6	2
β-strand	44-49	6	2
β-strand	55-58	4	3
β-strand	62-65	4	3
β-strand	67	1	4
β-strand	72	1	4
β-strand	75-77	3	3
α-helix	82-84	3
β-strand	86-89	4	2
β-strand	92	1	2
β-strand	110-115	6	2
α-helix	116-117	2
β-strand	125	1	5
β-strand	126-129	4	6
β-strand	139-142	4	6
β-strand	161-162	2	6
β-strand	168	1	7
β-strand	177	1	7
β-strand	181-183	3	6
α-helix	191-194	4
β-strand	205	1	5

Chain B: 4 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	8
β-strand	10-14	5	9
β-strand	19-24	6	8
β-strand	31-37	7	9
β-strand	38	1	10
β-strand	42	1	10
β-strand	45-51	7	9
β-strand	54-57	4	9
β-strand	65-68	4	8
β-strand	75-79	5	8
α-helix	84-86	3
β-strand	88-95	8	9
β-strand	107-108	2	9
β-strand	113-116A	5	9
β-strand	126-129	4	11
α-helix	134-140	7
β-strand	142-152	11	11
β-strand	157-163	7	12
β-strand	166-168	3	12
β-strand	174	1	11
α-helix	178	1
β-strand	179-180	2	11
β-strand	190-199	10	11
α-helix	200-203	4
β-strand	209-216	8	12
β-strand	219	1	13
β-strand	233	1	13
β-strand	235-242	8	12

Chain D: 4 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	27
β-strand	10-14	5	28
β-strand	19-24	6	27
β-strand	31-37	7	28
β-strand	38	1	29
β-strand	42	1	29
β-strand	45-49	5	28
β-strand	56-57	2	28
β-strand	65-68	4	27
β-strand	75-79	5	27
α-helix	84-86	3
β-strand	88-95	8	28
β-strand	107-108	2	28
β-strand	113-116A	5	28
β-strand	126-129	4	30
α-helix	134-140	7
β-strand	142-152	11	30
β-strand	157-161	5	31
β-strand	162-163	2	32
β-strand	166-167	2	32
β-strand	174	1	30
α-helix	178	1
β-strand	179-180	2	30
β-strand	190-199	10	30
α-helix	200-203	4
β-strand	209-216	8	31
β-strand	219	1	33
β-strand	233	1	33
β-strand	236-242	7	31

Chains H and I: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2-12	11	14
α-helix	20	1
β-strand	21-28	8	14
β-strand	31-37	7	14
β-strand	46-47	2	14
α-helix	50-54	5
α-helix	57-85	29
α-helix	87-88	2
β-strand	94-104	11	14
β-strand	109-118	10	14
β-strand	121-126	6	14
β-strand	133-135	3	14
α-helix	137-148	12
α-helix	152-158	7
α-helix	159-163	5
α-helix	164-180	17
β-strand	186-194	9	15
β-strand	198-206	9	15
β-strand	214-218	5	16
β-strand	223	1	16
β-strand	229-230	2	15
α-helix	232-233	2
β-strand	234-235	2	15
β-strand	241-250	10	15
α-helix	253-256	4
β-strand	258-262	5	16
β-strand	270-273	4	16

Chains L and M: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	4-5	2
β-strand	6-11	6	17
β-strand	21	1	18
β-strand	23-30	8	17
β-strand	36-41	6	19
β-strand	45	1	19
α-helix	51-54	4
β-strand	62-67	6	17
β-strand	70	1	18
β-strand	78-83	6	19
β-strand	92-94	3	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha, beta T cell receptor	A, C	protein	202	Mus musculus	P01738 (AlphaFold model)
Alpha, beta T cell receptor	B, D	protein	237	Mus musculus
Major histocompatibility complex class I molecule k(b)	H, I	protein	274	Mus musculus	P01901 (AlphaFold model)
DEV8 peptide	P, Q	protein	8		Q62425 (AlphaFold model)
Beta-2 microglobulin	L, M	protein	99	Mus musculus	P01887 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2CKB_1 ALPHA, BETA T CELL RECEPTOR (chains A, C)
QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVN
GFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAV
YALKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDATVLDMKAMDSKSNGAIAWSNQT
SFTCQDIFKETNATYPSSDVPC

Sequence of entity 2 (B, D), FASTA

>2CKB_2 ALPHA, BETA T CELL RECEPTOR (chains B, D)
EAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDI
PDGYKASRPSQENFSLILELATPSQTSVYFCASGGGGTLYFGAGTRLSVLEDLRNVTPPK
VSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSY
CLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADC

Sequence of entity 3 (H, I), FASTA

>2CKB_3 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I MOLECULE K(B) (chains H, I)
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYW
ERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDG
CDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLL
RTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGT
FQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW

Sequence of entity 4 (P, Q), FASTA

>2CKB_4 DEV8 PEPTIDE (chains P, Q)
EQYKFYSV

Sequence of entity 5 (L, M), FASTA

>2CKB_5 BETA-2 MICROGLOBULIN (chains L, M)
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDW
SFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM

Primary citation

Structural basis of plasticity in T cell receptor recognition of a self peptide-MHC antigen. Garcia, K.C., Degano, M., Pease, L.R. et al. Science (1998) 279:1166-1172. DOI 10.1126/science.279.5354.1166 · PubMed

Other PDB entries of the same protein (UniProt P01738 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OI9 2.35 Å, Structure of the 2C/Ld/QL9 allogeneic complex
1MWA 2.4 Å, 2C/H-2KBM3/DEV8 allogeneic complex
2ICW 2.41 Å, Crystal structure of a complete ternary complex between TCR, superantigen, and…
1I9E 2.5 Å, TCR domain
1TCR 2.5 Å, Murine T-cell antigen receptor 2C clone
4MXQ 2.6 Å, 42F3 TCR pCPC5/H-2Ld Complex
1G6R 2.8 Å, A functional hot spot for antigen recognition in a superagonist tcr/mhc complex
4N0C 2.9 Å, 42F3 TCR pCPE3/H-2Ld complex
4NHU 2.9 Å, The M33 TCR p3M33l/H-2 Ld Complex
3E3Q 2.95 Å, Structure of the 3alpham13 high-affinity mutant of the 2C TCR in complex with Ld/QL9
4N5E 3.06 Å, 42F3 TCR pCPA12/H-2Ld complex
4MVB 3.09 Å, 42F3 pCPB7/H-2Ld Complex

Browse more

2CKB is part of these collections:

Antibodies and the immune system

About this viewer

MolViewer shows 2CKB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.