1I9E: TCR domain

TCR domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 5 Dec 2001.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 1
Atoms: 963
Mol. weight: 13 kDa
Ligands: NAG
Released: 5 Dec 2001

Explore 1I9E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I9E contains 3 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	9-13	5	2
β-strand	18-20	3	3
β-strand	23-25	3	1
β-strand	31-37	7	2
β-strand	44-49	6	2
β-strand	55-57	3	3
α-helix	59-61	3
β-strand	63-65	3	3
β-strand	67	1	1
β-strand	72	1	1
β-strand	75-77	3	3
α-helix	82-84	3
β-strand	86-94	9	2
β-strand	97-101	5	2
β-strand	105-110	6	2
α-helix	111-112	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytotoxic tcell valpha domain	A	protein	115	Mus musculus	P01738 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1I9E_1 CYTOTOXIC TCELL VALPHA DOMAIN (chains A)
QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVN
GFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQN

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Crystal structure of an isolated V(alpha) domain of the 2C T-cell receptor. Rudolph, M.G., Huang, M., Teyton, L. et al. J Mol Biol (2001) 314:1-8. DOI 10.1006/jmbi.2001.5113 · PubMed

Other PDB entries of the same protein (UniProt P01738 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OI9 2.35 Å, Structure of the 2C/Ld/QL9 allogeneic complex
1MWA 2.4 Å, 2C/H-2KBM3/DEV8 allogeneic complex
2ICW 2.41 Å, Crystal structure of a complete ternary complex between TCR, superantigen, and…
1TCR 2.5 Å, Murine T-cell antigen receptor 2C clone
4MXQ 2.6 Å, 42F3 TCR pCPC5/H-2Ld Complex
1G6R 2.8 Å, A functional hot spot for antigen recognition in a superagonist tcr/mhc complex
4N0C 2.9 Å, 42F3 TCR pCPE3/H-2Ld complex
4NHU 2.9 Å, The M33 TCR p3M33l/H-2 Ld Complex
3E3Q 2.95 Å, Structure of the 3alpham13 high-affinity mutant of the 2C TCR in complex with Ld/QL9
2CKB 3.0 Å, Structure of the 2C/KB/DEV8 complex
4N5E 3.06 Å, 42F3 TCR pCPA12/H-2Ld complex
4MVB 3.09 Å, 42F3 pCPB7/H-2Ld Complex

Browse structure collections

About this viewer

MolViewer shows 1I9E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.