1GA3: Interleukin-13

NMR structure of interleukin-13. Determined by solution NMR. Released 4 Jul 2001.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 868
Mol. weight: 12.42 kDa
Released: 4 Jul 2001

Explore 1GA3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GA3 contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
β-strand	34-35	2	1
α-helix	44-51	8
α-helix	61-68	8
β-strand	89-90	2	1
α-helix	92-109	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-13	A	protein	113	Homo sapiens	P35225 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GA3_1 Interleukin-13 (chains A)
GGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAI
EKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Primary citation

Solution structure of interleukin-13 and insights into receptor engagement. Eisenmesser, E.Z., Horita, D.A., Altieri, A.S. et al. J Mol Biol (2001) 310:231-241. DOI 10.1006/jmbi.2001.4765 · PubMed

Other PDB entries of the same protein (UniProt P35225 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L5X 1.9 Å, Crystal structure of the complex between IL-13 and H2L6 FAB
4I77 1.9 Å, Lebrikizumab Fab bound to IL-13
5L6Y 1.99 Å, il13 in complex with tralokinumab
3L5W 2.0 Å, Crystal structure of the complex between IL-13 and C836 FAB
4PS4 2.8 Å, Crystal structure of the complex between IL-13 and M1295 FAB
3BPO 3.0 Å, Crystal structure of the IL13-IL4R-IL13Ra ternary complex
5E4E 3.0 Å, Engineered Interleukin-13 bound to receptor
3LB6 3.05 Å, The structure of IL-13 in complex with IL-13Ralpha2
3G6D 3.2 Å, Crystal structure of the complex between CNTO607 Fab and IL-13
8BLQ 3.97 Å, Cryo-EM structure of the CODV-IL13-RefAb triple complex
1IJZ Solution Structure of Human IL-13
1IK0 Solution Structure of Human IL-13

Browse structure collections

About this viewer

MolViewer shows 1GA3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.