1GWZ: SHP-1

Crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1. Determined by X-ray diffraction at 2.5 Å resolution. Released 22 Aug 1999.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,207
Mol. weight: 34.29 kDa
Released: 22 Aug 1999

Explore 1GWZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GWZ contains 12 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	266-268	3
α-helix	270-275	6
β-strand	288	1	1
α-helix	290-291	2
β-strand	306-309	4	1
β-strand	323-326	4	1
α-helix	331-333	3
α-helix	337-343	7
β-strand	348-351	4	1
β-strand	356-357	2	2
β-strand	360-361	2	2
α-helix	368-369	2
β-strand	370	1	1
β-strand	373-375	3	1
β-strand	380-383	4	1
β-strand	387	1	1
β-strand	392-399	8	1
β-strand	409-416	8	1
α-helix	432-442	11
β-strand	451-454	4	1
α-helix	461-478	18
α-helix	486-494	9
α-helix	504-507	4
α-helix	509-523	15
α-helix	525-527	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SHP-1	A	protein	299	Homo sapiens	P29350 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GWZ_1 SHP-1 (chains A)
GFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSDYI
NANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNKCV
PYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDHGV
PSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDI
DIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITY

Primary citation

Crystal structure of the catalytic domain of protein-tyrosine phosphatase SHP-1. Yang, J., Liang, X., Niu, T. et al. J Biol Chem (1998) 273:28199-28207. DOI 10.1074/jbc.273.43.28199 · PubMed

Other PDB entries of the same protein (UniProt P29350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GRZ 1.37 Å, Crystal structure of SHP1 catalytic domain with PO4
4HJP 1.4 Å, SHP-1 catalytic domain WPD loop open
4GRY 1.7 Å, Crystal structure of SHP1 catalytic domain with SO4
8YHI 1.75 Å, The Crystal Structure of SHP1 from Biortus.
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4HJQ 1.8 Å, SHP-1 catalytic domain WPD loop closed
1FPR 2.5 Å, Crystal structure of the complex formed between the catalytic domain of shp-1 and an in…
6SM5 2.75 Å, MbC/SHP1-C-SH2 complex
2B3O 2.8 Å, Crystal structure of human tyrosine phosphatase SHP-1
3PS5 3.1 Å, Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1
1X6C Solution structures of the SH2 domain of human protein-tyrosine phosphatase SHP-1
2RMX Solution structure of the SHP-1 C-terminal SH2 domain complexed with a…

Browse structure collections

About this viewer

MolViewer shows 1GWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.