1GYA: Human CD2

N-glycan and polypeptide NMR solution structures of the adhesion domain of human CD2. Determined by solution NMR. Released 8 Nov 1996.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 982
Mol. weight: 14.01 kDa
Released: 8 Nov 1996

Explore 1GYA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GYA contains 0 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	7-9	3	1
β-strand	17	1	2
β-strand	30-37	8	1
β-strand	42-48	7	1
β-strand	50	1	1
β-strand	54	1	1
β-strand	61-62	2	3
β-strand	68-69	2	3
β-strand	70	1	2
β-strand	80-87	8	1
β-strand	95-100	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human CD2	A	protein	105	Homo sapiens	P06729 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GYA_1 HUMAN CD2 (chains A)
KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTY
KLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQER

Primary citation

Conformation and function of the N-linked glycan in the adhesion domain of human CD2. Wyss, D.F., Choi, J.S., Li, J. et al. Science (1995) 269:1273-1278. PubMed

Other PDB entries of the same protein (UniProt P06729 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J6O 2.23 Å, Atypical polyproline recognition by the cms N-terminal SH3 domain. CMS:CD2 heterotrimer
1HNF 2.5 Å, Crystal structure of the extracellular region of the human cell adhesion molecule CD2 at…
2J7I 2.9 Å, Atypical polyproline recognition by the cms N-terminal SH3 domain. CMS:CD2 heterodimer
1QA9 3.2 Å, Structure of a Heterophilic Adhesion Complex Between the Human CD2 and CD58(LFA-3)…
1CDB Structure of the glycosylated adhesion domain of human T lymphocyte glycoprotein CD2
1L2Z CD2BP2-GYF domain in complex with proline-rich CD2 tail segment peptide

Browse structure collections

About this viewer

MolViewer shows 1GYA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.