Crystal structure of the extracellular region of the human cell adhesion molecule CD2 at 2.5 Å resolution. Determined by X-ray diffraction at 2.5 Å resolution. Released 7 Feb 1995.
Explore 1HNF in 3D Show helices and sheets RCSB PDB PDBe
1HNF contains 4 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-12 | 6 | 1 |
| β-strand | 17-19 | 3 | 2 |
| β-strand | 30-37 | 8 | 1 |
| α-helix | 38-40 | 3 | |
| β-strand | 43-47 | 5 | 1 |
| α-helix | 49-51 | 3 | |
| β-strand | 53-55 | 3 | 1 |
| β-strand | 60-62 | 3 | 2 |
| β-strand | 68-70 | 3 | 2 |
| α-helix | 75-77 | 3 | |
| β-strand | 79-87 | 9 | 1 |
| β-strand | 92-103 | 12 | 1 |
| α-helix | 104-109 | 6 | |
| β-strand | 110-114 | 5 | 3 |
| β-strand | 119-123 | 5 | 3 |
| β-strand | 131-136 | 6 | 4 |
| β-strand | 140-144 | 5 | 4 |
| β-strand | 148-151 | 4 | 3 |
| β-strand | 156-165 | 10 | 4 |
| β-strand | 170-179 | 10 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CD2 | A | protein | 182 | Homo sapiens | P06729 (AlphaFold model) |
>1HNF_1 CD2 (chains A) KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTY KLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTTL TCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCP EK
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
Water and common crystallization additives (NA) are not listed.
Crystal structure of the extracellular region of the human cell adhesion molecule CD2 at 2.5 A resolution. Bodian, D.L., Jones, E.Y., Harlos, K. et al. Structure (1994) 2:755-766. DOI 10.1016/S0969-2126(94)00076-X · PubMed
Other PDB entries of the same protein (UniProt P06729 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1HNF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.