1H8C: UBX domain from human faf1

UBX domain from human faf1. Determined by solution NMR. Released 13 Feb 2001.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 680
Mol. weight: 9.6 kDa
Released: 13 Feb 2001

Explore 1H8C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H8C contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	1
β-strand	17-22	6	1
β-strand	27	1	2
α-helix	28-38	11
β-strand	45-49	5	1
β-strand	54-55	2	1
β-strand	64	1	2
α-helix	65-68	4
β-strand	73-80	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fas-associated factor 1	A	protein	82	HOMO SAPIENS	Q9UNN5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1H8C_1 FAS-ASSOCIATED FACTOR 1 (chains A)
NAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLD
PNKSLLEVKLFPQETLFLEAKE

Primary citation

The Ubx Domain: A Widespread Ubiquitin-Like Module. Buchberger, A., Howard, M.J., Proctor, M. et al. J Mol Biol (2001) 307:17. DOI 10.1006/JMBI.2000.4462 · PubMed

Other PDB entries of the same protein (UniProt Q9UNN5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FGN 1.2 Å, The crystal structure of the FAF1 UBL1
3QX1 1.6 Å, Crystal structure of FAF1 UBX domain
3E21 1.73 Å, Crystal structure of FAF-1 UBA Domain
3QQ8 2.0 Å, Crystal structure of p97-N in complex with FAF1-UBX
3QWZ 2.0 Å, Crystal structure of FAF1 UBX-p97N-domain complex
3QC8 2.2 Å, Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The…
7FGM 2.2 Å, The complex crystals structure of the FAF1 UBL1_L-Hsp70 NBD with ADP and phosphate
3QCA 2.9 Å, Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The…
3R3M 3.0 Å, Crystal structure of the FAF1 UBX domain
8KG2 3.1 Å, Crystal structure of p97-N/D1 hexamer in complex with FAF1-UBX domain
9YW2 3.27 Å, Complex structure of human p97 bound to Faf1 and Ufd1 (NTD focused)
11TA 3.58 Å, Cryo-EM structure of substrate engaged p97-Ufd1-NPL4-Faf1 complex (motor focused)

Browse structure collections

About this viewer

MolViewer shows 1H8C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.