1HII: HIV-2 protease

Comparative analysis of the X-ray structures of HIV-1 and HIV-2 proteases in complex with cgp 53820, a novel pseudosymmetric inhibitor. Determined by X-ray diffraction at 2.3 Å resolution. Released 10 Jul 1995.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Human immunodeficiency virus 2
Chains: 2
Atoms: 1,755
Mol. weight: 22.22 kDa
Ligands: C20
Released: 10 Jul 1995

Explore 1HII in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HII contains 2 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
β-strand	10-15	6	2
β-strand	18-24	7	2
β-strand	32-33	2	2
β-strand	42-48	7	2
β-strand	53-66	14	2
β-strand	69-77	9	2
β-strand	84-85	2	2
α-helix	87-93	7
β-strand	96-98	3	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
β-strand	10-15	6	3
β-strand	18-24	7	3
β-strand	32-33	2	3
β-strand	43-49	7	3
β-strand	52-66	15	3
β-strand	69-77	9	3
β-strand	84-85	2	3
α-helix	87-93	7
β-strand	96-98	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HIV-2 protease	A, B	protein	99	Human immunodeficiency virus 2	P04584

Sequence of entity 1 (A, B), FASTA

>1HII_1 HIV-2 PROTEASE (chains A, B)
PQFSLWKRPVVTAYIEGQPVEVLLDTGADDSIVAGIELGNNYSPKIVGGIGGFINTKEYK
NVEIEVLNKKVRATIMTGDTPINIFGRNILTALGMSLNL

Ligands and cofactors

ID	Name	Formula	Copies
C20	Acetyl-nh-val-cyclohexyl-CH2[NCH2CHOH]CH2-benzyl-val-nh-acetyl	C31 H51 N5 O5	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Comparative analysis of the X-ray structures of HIV-1 and HIV-2 proteases in complex with CGP 53820, a novel pseudosymmetric inhibitor. Priestle, J.P., Fassler, A., Rosel, J. et al. Structure (1995) 3:381-389. DOI 10.1016/S0969-2126(01)00169-1 · PubMed

Other PDB entries of the same protein (UniProt P04584), best resolution first:

3EC0 1.18 Å, High Resolution HIV-2 Protease Structure in Complex with Antiviral Inhibitor GRL-06579A
3ECG 1.18 Å, High Resolution HIV-2 Protease Structure in Complex with Antiviral Inhibitor GRL-98065
3EBZ 1.2 Å, High Resolution HIV-2 Protease Structure in Complex with Clinical Drug Darunavir
1IDA 1.7 Å, Crystal structures of HIV-2 protease in complex with inhibitors containing the…
1HSH 1.9 Å, Crystal structure at 1.9 Å resolution of human immunodeficiency virus (HIV) II protease…
4UPJ 1.9 Å, Human immunodeficiency virus type 2 protease mutant with lys 57 replaced by leu (K57L)…
2HPE 2.0 Å, Comparison of the structures of HIV-2 protease complexes in three crystal space groups…
1IDB 2.2 Å, Crystal structures of HIV-2 protease in complex with inhibitors containing the…
2MIP 2.2 Å, Crystal structure of human immunodeficiency virus (HIV) type 2 protease in complex with…
5UPJ 2.3 Å, HIV-2 PROTEASE/U99283 complex
6UPJ 2.34 Å, HIV-2 PROTEASE/U99294 complex
1MU2 2.35 Å, Crystal structure of HIV-2 reverse transcriptase

Browse structure collections

About this viewer

MolViewer shows 1HII directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.