2MIP: HIV-2 protease

Crystal structure of human immunodeficiency virus (HIV) type 2 protease in complex with a reduced amide inhibitor and comparison with HIV-1 protease structures. Determined by X-ray diffraction at 2.2 Å resolution. Released 31 Oct 1993.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Human immunodeficiency virus 2
Chains: 8
Atoms: 3,326
Mol. weight: 45.97 kDa
Released: 31 Oct 1993

Explore 2MIP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MIP contains 4 α-helices and 45 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	10-15	6	2
β-strand	18-24	7	2
β-strand	32-33	2	2
β-strand	43-48	6	2
β-strand	49	1	3
β-strand	53-66	14	2
β-strand	69-77	9	2
β-strand	84-85	2	2
α-helix	87-93	7
β-strand	96-98	3	1

Chain B: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	10-15	6	4
β-strand	18-24	7	4
β-strand	28	1	5
β-strand	32-33	2	4
β-strand	43-49	7	4
β-strand	52-66	15	4
β-strand	69-77	9	4
β-strand	84-85	2	4
α-helix	87-92	6
β-strand	96-98	3	1

Chain C: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	6
β-strand	10-15	6	7
β-strand	18-24	7	7
β-strand	28	1	7
β-strand	32-33	2	7
β-strand	43-49	7	7
β-strand	52-66	15	7
β-strand	70-77	8	7
β-strand	83-85	3	7
α-helix	87-92	6
β-strand	96-98	3	6

Chain D: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	6
β-strand	10-15	6	8
β-strand	18-24	7	8
β-strand	28	1	9
β-strand	32-33	2	8
β-strand	43-48	6	8
β-strand	49	1	9
β-strand	53-66	14	8
β-strand	69-77	9	8
β-strand	84-85	2	8
α-helix	87-93	7
β-strand	96-98	3	6

Chains E, F, G and H: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	5	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HIV-2 protease	A, B, C, D	protein	99	Human immunodeficiency virus 2	P04584
Inhibitor bi-la-398	E, F, G, H	protein	7

Sequence of entity 1 (A, B, C, D), FASTA

>2MIP_1 HIV-2 PROTEASE (chains A, B, C, D)
PQFSLWKRPVVTAYIEGQPVEVLLDTGADDSIVAGIELGNNYSPKIVGGIGGFINTKEYK
NVEIEVLNKKVRATIMTGDTPINIFGRNILTALGMSLNL

Sequence of entity 2 (E, F, G, H), FASTA

>2MIP_2 INHIBITOR BI-LA-398 (chains E, F, G, H)
FVFLEIX

Primary citation

Crystal structure of human immunodeficiency virus (HIV) type 2 protease in complex with a reduced amide inhibitor and comparison with HIV-1 protease structures. Tong, L., Pav, S., Pargellis, C. et al. Proc Natl Acad Sci U S A (1993) 90:8387-8391. DOI 10.1073/pnas.90.18.8387 · PubMed

Other PDB entries of the same protein (UniProt P04584), best resolution first:

3EC0 1.18 Å, High Resolution HIV-2 Protease Structure in Complex with Antiviral Inhibitor GRL-06579A
3ECG 1.18 Å, High Resolution HIV-2 Protease Structure in Complex with Antiviral Inhibitor GRL-98065
3EBZ 1.2 Å, High Resolution HIV-2 Protease Structure in Complex with Clinical Drug Darunavir
1IDA 1.7 Å, Crystal structures of HIV-2 protease in complex with inhibitors containing the…
1HSH 1.9 Å, Crystal structure at 1.9 Å resolution of human immunodeficiency virus (HIV) II protease…
4UPJ 1.9 Å, Human immunodeficiency virus type 2 protease mutant with lys 57 replaced by leu (K57L)…
2HPE 2.0 Å, Comparison of the structures of HIV-2 protease complexes in three crystal space groups…
1IDB 2.2 Å, Crystal structures of HIV-2 protease in complex with inhibitors containing the…
1HII 2.3 Å, Comparative analysis of the X-ray structures of HIV-1 and HIV-2 proteases in complex…
5UPJ 2.3 Å, HIV-2 PROTEASE/U99283 complex
6UPJ 2.34 Å, HIV-2 PROTEASE/U99294 complex
1MU2 2.35 Å, Crystal structure of HIV-2 reverse transcriptase

Browse structure collections

About this viewer

MolViewer shows 2MIP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.