High Resolution HIV-2 Protease Structure in Complex with Clinical Drug Darunavir. Determined by X-ray diffraction at 1.2 Å resolution. Released 16 Sept 2008.
Explore 3EBZ in 3D Show helices and sheets RCSB PDB PDBe
3EBZ contains 2 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 10-15 | 6 | 2 |
| β-strand | 18-24 | 7 | 2 |
| β-strand | 32-33 | 2 | 2 |
| β-strand | 43-49 | 7 | 2 |
| β-strand | 52-66 | 15 | 2 |
| β-strand | 69-78 | 10 | 2 |
| β-strand | 84-85 | 2 | 2 |
| α-helix | 87-93 | 7 | |
| β-strand | 96-98 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 102-103 | 2 | 1 |
| β-strand | 110-115 | 6 | 3 |
| β-strand | 118-124 | 7 | 3 |
| β-strand | 132-133 | 2 | 3 |
| β-strand | 143-149 | 7 | 3 |
| β-strand | 152-166 | 15 | 3 |
| β-strand | 169-177 | 9 | 3 |
| β-strand | 184-185 | 2 | 3 |
| α-helix | 187-193 | 7 | |
| β-strand | 196-198 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protease | A, B | protein | 99 | Human immunodeficiency virus type 2 (ISOLATE ROD) | P04584 |
>3EBZ_1 Protease (chains A, B) PQFSLWKRPVVTAYIEGQPVEVLLDTGADDSIVAGIELGNNYSPKIVGGIGGFINTKEYK NVEIEVLNKKVRATIMTGDTPINIFGRNILTALGMSLNL
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 9 |
| 017 | (3R,3AS,6AR)-HEXAHYDROFURO[2,3-b]furan-3-YL(1S,2R)-3-[[(4-aminophenyl)sulfonyl]… | C27 H37 N3 O7 S | 1 |
Water and common crystallization additives (IMD, CL, NA) are not listed.
Structural evidence for effectiveness of darunavir and two related antiviral inhibitors against HIV-2 protease. Kovalevsky, A.Y., Louis, J.M., Aniana, A. et al. J Mol Biol (2008) 384:178-192. DOI 10.1016/j.jmb.2008.09.031 · PubMed
Other PDB entries of the same protein (UniProt P04584), best resolution first:
MolViewer shows 3EBZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.