HIV-2 PROTEASE/U99283 complex. Determined by X-ray diffraction at 2.3 Å resolution. Released 21 Apr 1997.
Explore 5UPJ in 3D Show helices and sheets RCSB PDB PDBe
5UPJ contains 2 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 10-15 | 6 | 2 |
| β-strand | 18-24 | 7 | 2 |
| β-strand | 32-33 | 2 | 2 |
| β-strand | 42-48 | 7 | 2 |
| β-strand | 53-66 | 14 | 2 |
| β-strand | 69-77 | 9 | 2 |
| β-strand | 84-85 | 2 | 2 |
| α-helix | 87-93 | 7 | |
| β-strand | 96-98 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-4 | 3 | 1 |
| β-strand | 10-15 | 6 | 3 |
| β-strand | 18-24 | 7 | 3 |
| β-strand | 32-33 | 2 | 3 |
| β-strand | 43-49 | 7 | 3 |
| β-strand | 52-66 | 15 | 3 |
| β-strand | 69-77 | 9 | 3 |
| β-strand | 84-85 | 2 | 3 |
| α-helix | 87-92 | 6 | |
| β-strand | 96-98 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| HIV-2 protease | A, B | protein | 99 | Human immunodeficiency virus 2 | P04584 |
>5UPJ_1 HIV-2 PROTEASE (chains A, B) PQFSLWKRPVVTAYIEGQPVEVLLDTGADDSIVAGIELGNNYSPKIVGGIGGFINTLEYK NVEIEVLNKKVRATIMTGDTPINIFGRNILTALGMSLNL
| ID | Name | Formula | Copies |
|---|---|---|---|
| UIN | 5,6,7,8,9,10-hexahydro-4-hydroxy-3-(1-phenylpropyl)cycloocta[b]pyran-2-one | C20 H24 O3 | 1 |
Use of medium-sized cycloalkyl rings to enhance secondary binding: discovery of a new class of human immunodeficiency virus (HIV) protease inhibitors. Romines, K.R., Watenpaugh, K.D., Tomich, P.K. et al. J Med Chem (1995) 38:1884-1891. DOI 10.1021/jm00011a008 · PubMed
Other PDB entries of the same protein (UniProt P04584), best resolution first:
MolViewer shows 5UPJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.