1HSH: Crystal structure

Crystal structure at 1.9 Å resolution of human immunodeficiency virus (HIV) II protease complexed with L-735,524, an orally bioavailable inhibitor of the HIV proteases. Determined by X-ray diffraction at 1.9 Å resolution. Released 3 Apr 1996.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Human immunodeficiency virus 2
Chains: 4
Atoms: 3,284
Mol. weight: 44.14 kDa
Ligands: MK1
Released: 3 Apr 1996

Explore 1HSH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HSH contains 4 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
β-strand	10-15	6	2
β-strand	18-24	7	2
β-strand	32-33	2	2
β-strand	43-49	7	2
β-strand	52-66	15	2
β-strand	69-77	9	2
β-strand	84-85	2	2
α-helix	87-93	7
β-strand	96-98	3	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	10-15	6	3
β-strand	18-24	7	3
β-strand	32-33	2	3
β-strand	43-49	7	3
β-strand	52-66	15	3
β-strand	69-77	9	3
β-strand	84-85	2	3
α-helix	87-92	6
β-strand	96-98	3	1

Chain C: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	4
β-strand	10-15	6	5
β-strand	18-24	7	5
β-strand	32-33	2	5
β-strand	43-49	7	5
β-strand	52-66	15	5
β-strand	69-77	9	5
β-strand	84-85	2	5
α-helix	87-93	7
β-strand	96-98	3	4

Chain D: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	4
β-strand	10-15	6	6
β-strand	19-24	6	6
β-strand	32-33	2	6
β-strand	43-48	6	6
β-strand	53-66	14	6
β-strand	69-78	10	6
β-strand	84-85	2	6
α-helix	87-93	7
β-strand	96-98	3	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HIV-II protease	A, B, C, D	protein	99	Human immunodeficiency virus 2	P04584

Sequence of entity 1 (A, B, C, D), FASTA

>1HSH_1 HIV-II PROTEASE (chains A, B, C, D)
PQFSLWKRPVVTAYIEGQPVEVLLDTGADDSIVAGIELGNNYSPKIVGGIGGFINTKEYK
NVEIEVLNKKVRATIMTGDTPINIFGRNILTALGMSLNL

Ligands and cofactors

ID	Name	Formula	Copies
MK1	N-[2(R)-hydroxy-1(S)-indanyl]-5-[(2(S)-tertiary butylaminocarbonyl)-4(3-pyridyl…	C36 H47 N5 O4	2

Primary citation

Crystal structure at 1.9-A resolution of human immunodeficiency virus (HIV) II protease complexed with L-735,524, an orally bioavailable inhibitor of the HIV proteases. Chen, Z., Li, Y., Chen, E. et al. J Biol Chem (1994) 269:26344-26348. PubMed

Other PDB entries of the same protein (UniProt P04584), best resolution first:

3EC0 1.18 Å, High Resolution HIV-2 Protease Structure in Complex with Antiviral Inhibitor GRL-06579A
3ECG 1.18 Å, High Resolution HIV-2 Protease Structure in Complex with Antiviral Inhibitor GRL-98065
3EBZ 1.2 Å, High Resolution HIV-2 Protease Structure in Complex with Clinical Drug Darunavir
1IDA 1.7 Å, Crystal structures of HIV-2 protease in complex with inhibitors containing the…
4UPJ 1.9 Å, Human immunodeficiency virus type 2 protease mutant with lys 57 replaced by leu (K57L)…
2HPE 2.0 Å, Comparison of the structures of HIV-2 protease complexes in three crystal space groups…
1IDB 2.2 Å, Crystal structures of HIV-2 protease in complex with inhibitors containing the…
2MIP 2.2 Å, Crystal structure of human immunodeficiency virus (HIV) type 2 protease in complex with…
1HII 2.3 Å, Comparative analysis of the X-ray structures of HIV-1 and HIV-2 proteases in complex…
5UPJ 2.3 Å, HIV-2 PROTEASE/U99283 complex
6UPJ 2.34 Å, HIV-2 PROTEASE/U99294 complex
1MU2 2.35 Å, Crystal structure of HIV-2 reverse transcriptase

Browse structure collections

About this viewer

MolViewer shows 1HSH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.