1MU2: HIV-2 reverse transcriptase

Crystal structure of HIV-2 reverse transcriptase. Determined by X-ray diffraction at 2.35 Å resolution. Released 30 Oct 2002.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Human immunodeficiency virus 2
Chains: 2
Atoms: 8,168
Mol. weight: 116.93 kDa
Released: 30 Oct 2002

Explore 1MU2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MU2 contains 55 α-helices and 69 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 42 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
β-strand	12	1	1
α-helix	13	1
β-strand	20	1	2
α-helix	28-44	17
β-strand	47-49	3	3
α-helix	50-51	2
β-strand	57	1	2
β-strand	58	1	3
β-strand	60-62	3	4
β-strand	73-75	3	4
α-helix	78-83	6
β-strand	84	1	1
α-helix	85-86	2
α-helix	97-99	3
β-strand	101	1	5
α-helix	102	1
β-strand	105-110	6	6
β-strand	112	1	7
α-helix	115-117	3
β-strand	119	1	8
α-helix	120-121	2
α-helix	125-128	4
β-strand	130-131	2	3
β-strand	143-146	4	3
β-strand	148	1	8
α-helix	149-150	2
α-helix	156-174	19
β-strand	179-183	5	6
β-strand	186-191	6	6
α-helix	195-211	17
β-strand	215	1	7
β-strand	221-222	2	6
β-strand	227-229	3	9
β-strand	232-234	3	9
β-strand	238-241	4	9
α-helix	242-245	4
β-strand	253	1	10
α-helix	254-270	17
α-helix	277-280	4
α-helix	291	1
β-strand	292	1	10
α-helix	293	1
α-helix	297-310	14
β-strand	314-317	4	9
β-strand	319	1	5
β-strand	326-331	6	11
β-strand	337-343	7	11
β-strand	346-353	8	11
β-strand	360-361	2	12
α-helix	363-382	20
α-helix	385-386	2
β-strand	387-390	4	11
β-strand	392	1	13
α-helix	394-403	10
β-strand	407	1	14
β-strand	413-415	3	11
α-helix	421	1
β-strand	422	1	13
β-strand	428-429	2	15
β-strand	437-445	9	15
β-strand	452-458	7	15
β-strand	463-468	6	15
α-helix	473-486	14
β-strand	491-496	6	15
α-helix	499-506	8
β-strand	511-512	2	12
α-helix	515-526	12
β-strand	529-534	6	15
α-helix	544-552	9

Chain B: 27 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	12	1	16
α-helix	13	1
β-strand	20	1	17
α-helix	21-25	5
α-helix	28-43	16
β-strand	47-49	3	18
α-helix	50-51	2
β-strand	57	1	17
β-strand	58	1	18
β-strand	60-63	4	19
β-strand	72-75	4	19
α-helix	78-83	6
β-strand	84	1	16
α-helix	100-102	3
β-strand	105-110	6	20
α-helix	112-117	6
β-strand	119	1	21
α-helix	125-128	4
β-strand	130-132	3	18
α-helix	135-137	3
β-strand	142-146	5	18
β-strand	148	1	21
α-helix	149-150	2
α-helix	155-173	19
β-strand	179-183	5	20
β-strand	186-191	6	20
α-helix	195-209	15
β-strand	231-234	4	20
α-helix	236-238	3
α-helix	239-241	3
β-strand	242	1	22
β-strand	243-244	2	23
β-strand	253	1	24
α-helix	254-267	14
α-helix	277-282	6
α-helix	291	1
β-strand	292	1	24
α-helix	293	1
α-helix	297-313	17
β-strand	326-331	6	22
β-strand	337-343	7	22
β-strand	346-352	7	22
α-helix	353-356	4
α-helix	363-382	20
α-helix	385-386	2
β-strand	387-390	4	22
β-strand	392	1	14
α-helix	394-400	7
α-helix	401-404	4
β-strand	413-415	3	22
α-helix	420-425	6
α-helix	426-428	3
β-strand	429-430	2	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HIV-2 rt	A	protein	555	Human immunodeficiency virus 2	P04584
HIV-2 rt	B	protein	426	Human immunodeficiency virus 2	P04584

Sequence of entity 1 (A), FASTA

>1MU2_1 HIV-2 RT (chains A)
PVAKVEPIKIMLKPGKDGPKLRQWPLTKEKIEALKEICEKMEKEGQLEEAPPTNPYNTPT
FAIKKKDKNKWRMLIDFRELNKVTQDFTEIQLGIPHPAGLAKKRRITVLDVGDAYFSIPL
HEDFRPYTAFTLPSVNNAEPGKRYIYKVLPQGWKGSPAIFQHTMRQVLEPFRKANKDVII
IQYMDDILIASDRTDLEHDRVVLQLKELLNGLGFSTPDEKFQKDPPYHWMGYELWPTKWK
LQKIQLPQKEIWTVNDIQKLVGVLNWAAQLYPGIKTKHLCRLISGKMTLTEEVQWTELAE
AELEENRIILSQEQEGHYYQEEKELEATVQKDQDNQWTYKIHQEEKILKVGKYAKVKNTH
TNGIRLLAQVVQKIGKEALVIWGRIPKFHLPVEREIWEQWWDNYWQVTWIPDWDFVSTPP
LVRLAFNLVGDPIPGAETFYTDGSCNRQSKEGKAGYVTDRGKDKVKKLEQTTNQQAELEA
FAMALTDSGPKVNIIVDSQYVMGIVASQPTESESKIVNQIIEEMIKKEAIYVAWVPAHKG
IGGNQEVDHLVSQGI

Sequence of entity 2 (B), FASTA

>1MU2_2 HIV-2 RT (chains B)
EPIKIMLKPGKDGPKLRQWPLTKEKIEALKEICEKMEKEGQLEEAPPTNPYNTPTFAIKK
KDKNKWRMLIDFRELNKVTQDFTEIQLGIPHPAGLAKKRRITVLDVGDAYFSIPLHEDFR
PYTAFTLPSVNNAEPGKRYIYKVLPQGWKGSPAIFQHTMRQVLEPFRKANKDVIIIQYMD
DILIASDRTDLEHDRVVLQLKELLNGLGFSTPDEKFQKDPPYHWMGYELWPTKWKLQKIQ
LPQKEIWTVNDIQKLVGVLNWAAQLYPGIKTKHLCRLISGKMTLTEEVQWTELAEAELEE
NRIILSQEQEGHYYQEEKELEATVQKDQDNQWTYKIHQEEKILKVGKYAKVKNTHTNGIR
LLAQVVQKIGKEALVIWGRIPKFHLPVEREIWEQWWDNYWQVTWIPDWDFVSTPPLVRLA
FNLVGD

Primary citation

Structure of HIV-2 reverse transcriptase at 2.35-A resolution and the mechanism of resistance to non-nucleoside inhibitors. Ren, J., Bird, L.E., Chamberlain, P.P. et al. Proc Natl Acad Sci U S A (2002) 99:14410-14415. DOI 10.1073/pnas.222366699 · PubMed

Other PDB entries of the same protein (UniProt P04584), best resolution first:

3EC0 1.18 Å, High Resolution HIV-2 Protease Structure in Complex with Antiviral Inhibitor GRL-06579A
3ECG 1.18 Å, High Resolution HIV-2 Protease Structure in Complex with Antiviral Inhibitor GRL-98065
3EBZ 1.2 Å, High Resolution HIV-2 Protease Structure in Complex with Clinical Drug Darunavir
1IDA 1.7 Å, Crystal structures of HIV-2 protease in complex with inhibitors containing the…
1HSH 1.9 Å, Crystal structure at 1.9 Å resolution of human immunodeficiency virus (HIV) II protease…
4UPJ 1.9 Å, Human immunodeficiency virus type 2 protease mutant with lys 57 replaced by leu (K57L)…
2HPE 2.0 Å, Comparison of the structures of HIV-2 protease complexes in three crystal space groups…
1IDB 2.2 Å, Crystal structures of HIV-2 protease in complex with inhibitors containing the…
2MIP 2.2 Å, Crystal structure of human immunodeficiency virus (HIV) type 2 protease in complex with…
1HII 2.3 Å, Comparative analysis of the X-ray structures of HIV-1 and HIV-2 proteases in complex…
5UPJ 2.3 Å, HIV-2 PROTEASE/U99283 complex
6UPJ 2.34 Å, HIV-2 PROTEASE/U99294 complex

Browse structure collections

About this viewer

MolViewer shows 1MU2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.